Property Summary

NCBI Gene PubMed Count 4
PubMed Score 9.52
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
hepatocellular carcinoma -1.100 4.2e-06
osteosarcoma 1.059 6.5e-04
ependymoma 1.200 7.4e-09
atypical teratoid / rhabdoid tumor 1.300 4.2e-05
glioblastoma 1.500 3.5e-05
medulloblastoma 1.300 9.3e-05
medulloblastoma, large-cell 1.800 2.8e-06
primitive neuroectodermal tumor 1.100 3.0e-04
juvenile dermatomyositis 1.205 2.3e-11
acute quadriplegic myopathy 1.223 6.7e-05
tuberculosis and treatment for 6 months 1.200 7.1e-05
diabetes mellitus -1.100 3.4e-03
spina bifida -1.709 2.6e-02
acute myeloid leukemia 1.600 4.7e-03

Synonym

Accession Q6IQ49 A8K4P3 Q5TD36 Q6ZS26 Q8NAG7
Symbols C1orf55
dJ671D7.1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MAEAAALVWIRGPGFGCKAVRCASGRCTVRDFIHRHCQDQNVPVENFFVKCNGALINTSDTVQHGAVYSL      1 - 70
EPRLCGGKGGFGSMLRALGAQIEKTTNREACRDLSGRRLRDVNHEKAMAEWVKQQAEREAEKEQKRLERL     71 - 140
QRKLVEPKHCFTSPDYQQQCHEMAERLEDSVLKGMQAASSKMVSAEISENRKRQWPTKSQTDRGASAGKR    141 - 210
RCFWLGMEGLETAEGSNSESSDDDSEEAPSTSGMGFHAPKIGSNGVEMAAKFPSGSQRARVVNTDHGSPE    211 - 280
QLQIPVTDSGRHILEDSCAELGESKEHMESRMVTETEETQEKKAESKEPIEEEPTGAGLNKDKETEERTD    281 - 350
GERVAEVAPEERENVAVAKLQESQPGNAVIDKETIDLLAFTSVAELELLGLEKLKCELMALGLKCGGTLQ    351 - 420
ERAARLFSVRGLAKEQIDPALFAKPLKGKKK                                           421 - 451
//

Text Mined References (14)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21333630 2011 Sde2: a novel nuclear protein essential for telomeric silencing and genomic stability in Schizosaccharomyces pombe.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.