Property Summary

NCBI Gene PubMed Count 89
PubMed Score 226.21
PubTator Score 245.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytoma 1.200 2.0e-02
autosomal dominant Emery-Dreifuss muscul... 1.243 2.5e-03
dermatomyositis 1.500 6.9e-04
diabetes mellitus -1.100 6.5e-03
Duchenne muscular dystrophy 1.230 5.7e-07
glioblastoma 1.500 1.6e-04
lung cancer -1.300 3.9e-04
lung carcinoma -1.300 1.2e-20
medulloblastoma, large-cell -1.100 6.4e-03
ovarian cancer -2.100 1.4e-07
subependymal giant cell astrocytoma 1.894 1.8e-02
Waldenstrons macroglobulinemia 1.460 2.9e-02

 MGI Phenotype (1)

PDB (12)

Gene RIF (46)

AA Sequence

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV      1 - 70
AVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQL     71 - 140
VQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG    141 - 210
FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK    211 - 280
RMAPSIMKSLMDHTIPEV                                                        281 - 298
//

Text Mined References (98)

PMID Year Title