Property Summary

NCBI Gene PubMed Count 82
PubMed Score 209.86
PubTator Score 245.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.460 2.9e-02
astrocytoma 1.200 2.0e-02
glioblastoma 1.500 1.6e-04
medulloblastoma, large-cell -1.100 6.4e-03
Duchenne muscular dystrophy 1.230 5.7e-07
autosomal dominant Emery-Dreifuss muscul... 1.243 2.5e-03
lung cancer -1.400 5.3e-05
diabetes mellitus -1.100 6.5e-03
subependymal giant cell astrocytoma 1.894 1.8e-02
lung carcinoma -1.300 1.2e-20
ovarian cancer -2.100 1.4e-07
dermatomyositis 1.500 6.9e-04

 MGI Phenotype (1)

Gene RIF (43)

PMID Text
26787460 Data suggest that syntenin/SDCBP PDZ domains 1 and 2 recognize a broad range of peptide ligands with preferences for nectin-1, hydrophobic amino acid motifs, and cryptic internal ligands/peptide fragments.
26561205 Data show that patients with high MDA-9/Syntenin and high Slug expressions were associated with poor overall survival compared to those with low expression in lung adenocarcinomas.
26093898 To predict mda-9's association with extracellular matrix organization.
25893292 these findings demonstrate that syntenin may act as an important positive regulator of TGF-b signaling by regulating caveolin-1-mediated internalization of TbRI; thus, providing a novel function for syntenin that is linked to cancer progression.
25480418 MDA-9, co-expressed with GRP78, as a melanoma protein associated with lymph node metastasis. Investigating how MDA-9 and GRP78 interact to contribute to melanoma metastasis and disease progression could reveal new potential avenues of targeted therapy
24662291 ALCAM stably interacts with actin by binding to syntenin-1 and ezrin.
24637612 Syntenin-ALIX exosome biogenesis and budding into multivesicular bodies are controlled by ARF6 and PLD2.
24305713 High MDA-9 expresison is associated with glioma.
23873690 Our findings indicate that MDA-9/Syntenin might provide an attractive target for developing detection, monitoring, and therapeutic strategies for managing Urothelial cell carcinoma .
23533663 Results suggested that SDCBP played an important role in tumor growth of ER-negative breast cancers.
23233738 Our studies delineate an unanticipated cell nonautonomous function of MDA-9/syntenin in the context of angiogenesis, which may directly contribute to its metastasis-promoting properties
23066033 Findings establish RKIP as an inhibitor of MDA-9-dependent melanoma metastasis.
22938480 results indicate Mda-9/syntenin overexpression could activate FAK-JNK and FAK-Akt signaling and then enhance the migration capacity of human brain glioma cells.
22721673 HIV-1 Nef inhibits the expression of syndecan binding protein (syntenin) in human podocyte
22535526 Data show that syntenin-1 is recruited to the plasma membrane during HIV-1 attachment.
22535526 HIV-1 Nef inhibits the expression of syndecan binding protein (syntenin) in human podocyte
22349701 the key role of syntenin-1 is the generation of functional asymmetry in T cells and provide a novel mechanistic link between receptor activation and actin polymerization and accumulation in response to extracellular stimulation.
22267972 mda-9/syntenin is involved in uveal melanoma progression
22201728 MDA-9/syntenin functions as a positive regulator of melanoma progression and metastasis through interactions with c-Src and promotes the formation of an active FAK/c-Src signaling complex leading to NF-k B and matrix metalloproteinase activation. Review.
22190034 HIV-1 Nef inhibits the expression of syndecan binding protein (syntenin) in human podocyte
21986941 our data demonstrate that the Sox4 C-terminal domain regulates polyubiquitin-independent proteasomal degradation of Sox4 that can be modulated by interaction with syntenin
21949238 ubiquitin-dependent pathway involving syntenin-1 that is regulated by Ulk1.
21828040 mda-9/syntenin, a positive regulator of cancer metastasis, regulates the activation of Akt (also known as protein kinase B) by facilitating ILK adaptor function during adhesion to type I collagen (COL-I) in human breast cancer cells.
21569759 the cytoplasmic domain of syndecan-2 regulates colon cancer cell migration via interaction with syntenin-1.
21359963 showed that overexpression of wild-type MDA-9/syntenin enhances formation of filopodia, whereas MDA-9/syntenin lacking the PDZ domain inhibits the formation of filopodia
20233700 ST1 were up-regulated with the malignancy of prostate cancer cell lines and have their potential as serum biomarkers for indicating the developmental stage of prostate cancer.
20228839 Large/zonula occludens-1 domains of MDA-9 represent a promosing potential therapeutic target for preventing cancer progression and metastatic spread
20145126 Mda-9/syntenin acts as a molecular adaptor linking PKCalpha and FAK activation in a pathway of FN adhesion by human cancer cells.
19654410 Syntenin forms complexes with multiple IL-5Ralpha chains
19592421 Syntenin-1 serves as one of IgA-inducing factors for B cells.
19228696 Data show that syntenin-1 binds to syndecan-1 and participates in the formation of membrane protrusions, and that syntenin-1 recruitment depends on the dephosphorylation of Tyr-309 located within syndecan-1 PDZ binding domain EFYA.
18839981 Syntenin interacts with the aminoacyl tRNA synthetase complex in a lysyl-tRNA synthetase-dependent manner.
18832467 data are compatible with a model wherein interaction of MDA-9/syntenin with c-Src promotes the formation of an active FAK/c-Src signaling complex, leading to enhanced tumor cell invasion and metastatic spread
18256285 Syntenin stimulates c-jun phosphorylation and modulates Frizzled 7 signaling, in particular the PKCalpha/CDC42 noncanonical Wnt signaling cascade.
18234474 Suggest that syntenin is a physiological suppressor of TRAF6 and plays an inhibitory role in IL-1R- and TLR4- mediated NF-kappaB activation pathways.
17666427 Syntenin binding to Delta1 plays a dual role in promoting intercellular adhesion and regulating Notch signalling.
17451681 Together, these results suggest that downregulation of syntenin by RNA interference could provide a means of inhibiting tumor invasion and possibly metastasis in different cancers, and point to syntenin as a potential cancer biomarker and drug target.
16322237 Study provides the first direct link between mda-9/syntenin expression and tumor cell dissemination in vivo and indicates that mda-9/syntenin expression activates specific signal transduction pathways.
15518882 This review discusses the identification, structure and function of mda-9/syntenin and delineates future studies to address its role in regulating key physiological and pathological processes.
15371445 eIF5A may be a regulator of p53, and syntenin might regulate p53 by balancing the regulation of eIF5A signaling to p53 for apoptosis
15254681 melanoma metastasis is associated with increased expression of the syntenin gene which may participate in signal transduction and cell adhesion via the multifunctional protein-binding properties of its tandem PDZ domains
12775419 HIV-1 Nef inhibits the expression of syndecan binding protein (syntenin) in human podocyte
12679023 Data show that the functional properties of syntenin are a result of independent interactions with target peptides.

AA Sequence

MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANV      1 - 70
AVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQL     71 - 140
VQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVG    141 - 210
FIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIK    211 - 280
RMAPSIMKSLMDHTIPEV                                                        281 - 298
//

Text Mined References (93)

PMID Year Title
27386966 2016 Frizzled 7 and PIP2 binding by syntenin PDZ2 domain supports Frizzled 7 trafficking and signalling.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26787460 2016 Proteomic peptide phage display uncovers novel interactions of the PDZ1-2 supramodule of syntenin.
26561205 2016 MDA-9/Syntenin-Slug transcriptional complex promote epithelial-mesenchymal transition and invasion/metastasis in lung adenocarcinoma.
26539120 2015 Syntenin controls migration, growth, proliferation, and cell cycle progression in cancer cells.
26291527 2016 MDA-9/Syntenin Control.
26093898 2015 Examination of Epigenetic and other Molecular Factors Associated with mda-9/Syntenin Dysregulation in Cancer Through Integrated Analyses of Public Genomic Datasets.
26032692 2015 Syntenin and syndecan in the biogenesis of exosomes.
25893292 2016 Syntenin regulates TGF-?1-induced Smad activation and the epithelial-to-mesenchymal transition by inhibiting caveolin-mediated TGF-? type I receptor internalization.
25480418 2015 MDA-9 and GRP78 as potential diagnostic biomarkers for early detection of melanoma metastasis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25219541 2015 Targeting tumor invasion: the roles of MDA-9/Syntenin.
25144756 2014 Schistosome syntenin partially protects vaccinated mice against Schistosoma mansoni infection.
24769233 2014 Proteomic analysis of cerebrospinal fluid extracellular vesicles: a comprehensive dataset.
24662291 2014 Syntenin-1 and ezrin proteins link activated leukocyte cell adhesion molecule to the actin cytoskeleton.
24637612 2014 Syntenin-ALIX exosome biogenesis and budding into multivesicular bodies are controlled by ARF6 and PLD2.
24305713 2014 MDA-9/syntenin is a key regulator of glioma pathogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23873690 2013 Novel role of MDA-9/syntenin in regulating urothelial cell proliferation by modulating EGFR signaling.
23533663 2013 Syndecan binding protein (SDCBP) is overexpressed in estrogen receptor negative breast cancers, and is a potential promoter for tumor proliferation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23233738 2013 MDA-9/syntenin and IGFBP-2 promote angiogenesis in human melanoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23066033 2012 Raf kinase inhibitor RKIP inhibits MDA-9/syntenin-mediated metastasis in melanoma.
22938480 2012 Mda-9/syntenin promotes human brain glioma migration through focal adhesion kinase (FAK)-JNK and FAK-AKT signaling.
22673509 2012 Extensions of PSD-95/discs large/ZO-1 (PDZ) domains influence lipid binding and membrane targeting of syntenin-1.
22660413 2012 Syndecan-syntenin-ALIX regulates the biogenesis of exosomes.
22535526 2012 The PDZ-adaptor protein syntenin-1 regulates HIV-1 entry.
22516433 2012 Proteomic analysis of microvesicles from plasma of healthy donors reveals high individual variability.
22349701 2012 Association of syntenin-1 with M-RIP polarizes Rac-1 activation during chemotaxis and immune interactions.
22267972 2012 Mda-9/syntenin is expressed in uveal melanoma and correlates with metastatic progression.
22201728 2012 MDA-9/syntenin: a positive gatekeeper of melanoma metastasis.
21986941 2012 Syntenin-mediated regulation of Sox4 proteasomal degradation modulates transcriptional output.
21949238 2011 Binding to syntenin-1 protein defines a new mode of ubiquitin-based interactions regulated by phosphorylation.
21828040 2011 mda-9/Syntenin protein positively regulates the activation of Akt protein by facilitating integrin-linked kinase adaptor function during adhesion to type I collagen.
21569759 2011 Syndecan-2 cytoplasmic domain regulates colon cancer cell migration via interaction with syntenin-1.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
21359963 2011 MDA-9/syntenin interacts with ubiquitin via a novel ubiquitin-binding motif.
21269460 2011 Initial characterization of the human central proteome.
21082674 2010 Comprehensive analysis of low-abundance proteins in human urinary exosomes using peptide ligand library technology, peptide OFFGEL fractionation and nanoHPLC-chip-MS/MS.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20233700 2010 [Identification and expression of two new secretory proteins associated with prostate cancer].
20228839 2010 Src kinase activation is mandatory for MDA-9/syntenin-mediated activation of nuclear factor-kappaB.
20145126 2010 Activation of the integrin effector kinase focal adhesion kinase in cancer cells is regulated by crosstalk between protein kinase Calpha and the PDZ adapter protein mda-9/Syntenin.
19654410 2009 Regulation of myelopoiesis through syntenin-mediated modulation of IL-5 receptor output.
19592421 2009 A novel immunoregulatory protein in human colostrum, syntenin-1, for promoting the development of IgA-producing cells from cord blood B cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19228696 2009 Tyrosine dephosphorylation of the syndecan-1 PDZ binding domain regulates syntenin-1 recruitment.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18839981 2008 The tandem PDZ protein Syntenin interacts with the aminoacyl tRNA synthetase complex in a lysyl-tRNA synthetase-dependent manner.
18832467 2008 mda-9/Syntenin promotes metastasis in human melanoma cells by activating c-Src.
18256285 2008 The postsynaptic density 95/disc-large/zona occludens protein syntenin directly interacts with frizzled 7 and supports noncanonical Wnt signaling.
18234474 2008 Syntenin negatively regulates TRAF6-mediated IL-1R/TLR4 signaling.
17666427 2007 Syntenin mediates Delta1-induced cohesiveness of epidermal stem cells in culture.
17451681 2007 The tandem PDZ domains of syntenin promote cell invasion.
17081065 2006 Proteomic and bioinformatic characterization of the biogenesis and function of melanosomes.
16533050 2006 The binding of the PDZ tandem of syntenin to target proteins.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322237 2005 mda-9/Syntenin: a positive regulator of melanoma metastasis.
15518882 2004 mda-9/syntenin: recent insights into a novel cell signaling and metastasis-associated gene.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371445 2004 A novel eIF5A complex functions as a regulator of p53 and p53-dependent apoptosis.
15276154 2004 The neuronal glycine transporter 2 interacts with the PDZ domain protein syntenin-1.
15254681 2004 Melanoma metastasis is associated with enhanced expression of the syntenin gene.
15126321 2004 Syndecan-1 up-regulated by ephrinB2/EphB4 plays dual roles in inflammatory angiogenesis.
15081807 2004 The PDZ2 domain of syntenin at ultra-high resolution: bridging the gap between macromolecular and small molecule crystallography.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842047 2003 Molecular roots of degenerate specificity in syntenin's PDZ2 domain: reassessment of the PDZ recognition paradigm.
12679023 2003 PDZ tandem of human syntenin: crystal structure and functional properties.
12643545 Proteomic analysis of early melanosomes: identification of novel melanosomal proteins.
12597860 2003 Rapid and differential regulation of AMPA and kainate receptors at hippocampal mossy fibre synapses by PICK1 and GRIP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403354 2002 Evaluating function of transmembrane protein tyrosine phosphatase CD148 in lymphocyte biology.
12241528 2002 Cytoplasmic interactions of syndecan-4 orchestrate adhesion receptor and growth factor receptor signalling.
12202822 2002 SynCAM, a synaptic adhesion molecule that drives synapse assembly.
12037664 2002 Syntenin is overexpressed and promotes cell migration in metastatic human breast and gastric cancer cell lines.
11891216 2002 The PDZ proteins PICK1, GRIP, and syntenin bind multiple glutamate receptor subtypes. Analysis of PDZ binding motifs.
11498591 2001 Cytokine-specific transcriptional regulation through an IL-5Ralpha interacting protein.
11432873 2001 Schwannomin isoform-1 interacts with syntenin via PDZ domains.
11179419 2001 Characterization of syntenin, a syndecan-binding PDZ protein, as a component of cell adhesion sites and microfilaments.
11152476 2001 The neural cell recognition molecule neurofascin interacts with syntenin-1 but not with syntenin-2, both of which reveal self-associating activity.
10770943 2000 Syntenin-syndecan binding requires syndecan-synteny and the co-operation of both PDZ domains of syntenin.
10473577 1999 Identification of syntenin as a protein of the apical early endocytic compartment in Madin-Darby canine kidney cells.
10230395 1999 A role for a PDZ protein in the early secretory pathway for the targeting of proTGF-alpha to the cell surface.
9920925 1999 The carboxyl terminus of B class ephrins constitutes a PDZ domain binding motif.
9883737 1998 PDZ proteins bind, cluster, and synaptically colocalize with Eph receptors and their ephrin ligands.
9511750 1998 Melanoma differentiation associated gene-9, mda-9, is a human gamma interferon responsive gene.
9391086 1997 Syntenin, a PDZ protein that binds syndecan cytoplasmic domains.