Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.15
PubTator Score 4.51

Knowledge Summary

Patent (582)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 1.100 3.5e-02
ependymoma 1.500 2.1e-02
oligodendroglioma 1.100 4.3e-02
psoriasis 1.100 7.6e-06
osteosarcoma 3.180 1.1e-05
group 4 medulloblastoma 2.000 4.0e-04
atypical teratoid / rhabdoid tumor 1.700 1.1e-03
glioblastoma 1.800 3.6e-04
medulloblastoma, large-cell 2.300 4.3e-06
primitive neuroectodermal tumor 1.200 9.5e-05
adrenocortical carcinoma 1.416 2.8e-03
pancreatic ductal adenocarcinoma liver m... -1.286 1.2e-02
non-small cell lung cancer 1.119 5.8e-09
sarcoidosis 1.200 1.4e-02
Breast cancer 2.600 2.5e-02
pediatric high grade glioma 1.200 6.3e-03
invasive ductal carcinoma 1.400 9.8e-03
ovarian cancer 2.000 2.3e-05
Gaucher disease type 1 -1.300 1.6e-02

Gene RIF (8)

PMID Text
25496667 Genome-wide shRNA screening identifies SCYL2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23047923 results suggest that SCYL2 serves as a regulatory factor for Vpu, reducing the extent of Vpu phosphorylation and consequently enhancing BST2-mediated viral restriction.
23047923 Genome-wide shRNA screening identifies SCYL2, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
23047923 Knockdown of SCY1-like 2 (SCYL2) by siRNA enhances HIV-1 release in transfected HeLa cells
19643732 Studies identify CVAK104 as a novel binding partner of Dishevelled (Dvl) and that CVAK104 also interacts with Fzd5.
17587408 CVAK104 is an evolutionarily conserved protein involved in SNARE sorting that is essential for normal embryonic development
16914521 Together, our data suggest a function for CVAK104 in clathrin-dependent pathways between the trans-Golgi network and the endosomal system.
15809293 CVAK104 binds ATP and functions in vitro as a poly-L-lysine-stimulated kinase that is capable of autophosphorylation and phosphorylating the beta2-adaptin subunit of AP2.

AA Sequence

MESMLNKLKSTVTKVTADVTSAVMGNPVTREFDVGRHIASGGNGLAWKIFNGTKKSTKQEVAVFVFDKKL      1 - 70
IDKYQKFEKDQIIDSLKRGVQQLTRLRHPRLLTVQHPLEESRDCLAFCTEPVFASLANVLGNWENLPSPI     71 - 140
SPDIKDYKLYDVETKYGLLQVSEGLSFLHSSVKMVHGNITPENIILNKSGAWKIMGFDFCVSSTNPSEQE    141 - 210
PKFPCKEWDPNLPSLCLPNPEYLAPEYILSVSCETASDMYSLGTVMYAVFNKGKPIFEVNKQDIYKSFSR    211 - 280
QLDQLSRLGSSSLTNIPEEVREHVKLLLNVTPTVRPDADQMTKIPFFDDVGAVTLQYFDTLFQRDNLQKS    281 - 350
QFFKGLPKVLPKLPKRVIVQRILPCLTSEFVNPDMVPFVLPNVLLIAEECTKEEYVKLILPELGPVFKQQ    351 - 420
EPIQILLIFLQKMDLLLTKTPPDEIKNSVLPMVYRALEAPSIQIQELCLNIIPTFANLIDYPSMKNALIP    421 - 490
RIKNACLQTSSLAVRVNSLVCLGKILEYLDKWFVLDDILPFLQQIPSKEPAVLMGILGIYKCTFTHKKLG    491 - 560
ITKEQLAGKVLPHLIPLSIENNLNLNQFNSFISVIKEMLNRLESEHKTKLEQLHIMQEQQKSLDIGNQMN    561 - 630
VSEEMKVTNIGNQQIDKVFNNIGADLLTGSESENKEDGLQNKHKRASLTLEEKQKLAKEQEQAQKLKSQQ    631 - 700
PLKPQVHTPVATVKQTKDLTDTLMDNMSSLTSLSVSTPKSSASSTFTSVPSMGIGMMFSTPTDNTKRNLT    701 - 770
NGLNANMGFQTSGFNMPVNTNQNFYSSPSTVGVTKMTLGTPPTLPNFNALSVPPAGAKQTQQRPTDMSAL    771 - 840
NNLFGPQKPKVSMNQLSQQKPNQWLNQFVPPQGSPTMGSSVMGTQMNVIGQSAFGMQGNPFFNPQNFAQP    841 - 910
PTTMTNSSSASNDLKDLFG                                                       911 - 929
//

Text Mined References (17)

PMID Year Title
23341777 2013 Genome-wide association study identifies a novel susceptibility locus at 12q23.1 for lung squamous cell carcinoma in han chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047923 2012 Interferon-induced SCYL2 limits release of HIV-1 by triggering PP2A-mediated dephosphorylation of the viral protein Vpu.
21269460 2011 Initial characterization of the human central proteome.
19643732 2009 A coated vesicle-associated kinase of 104 kDa (CVAK104) induces lysosomal degradation of frizzled 5 (Fzd5).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17587408 2007 CVAK104 is a novel regulator of clathrin-mediated SNARE sorting.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16914521 2006 Clathrin-dependent association of CVAK104 with endosomes and the trans-Golgi network.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15809293 2005 CVAK104 is a novel poly-L-lysine-stimulated kinase that targets the beta2-subunit of AP2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.