Property Summary

NCBI Gene PubMed Count 33
PubMed Score 51.69
PubTator Score 30.89

Knowledge Summary

Patent (12,114)

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.900 5.6e-07

Pathway (1)

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
26581903 Disruptive SCYL1 mutations underlie a syndrome characterized by recurrent episodes of liver failure, peripheral neuropathy, cerebellar atrophy, and ataxia.
25575811 Data identified the large GTPase dynamin2 as an interacting protein of NTKL, which might be responsible for the phenotype alterations caused by NTKL overexpression, such as cytokinesis failure, increased cell motility and abnormal of cell division.
24769208 TEIF is a downstream effector in EGF/PI3K/Akt signaling.
24481816 Data reveal that Scyl1 is a key organizer of a subset of the COPI machinery.
24361335 TEIF as a novel MSP58-interacting protein.
22570270 suggested that the interaction of SCYL1BP1/Pirh2 could accelerate Pirh2 degradation through an ubiquitin-dependent pathway. SCYL1BP1 may function as an important tumor suppressor gene in HCC development
20598683 SCYL1-BP1 can be ubiquitinated and degraded by Pirh2 but not by MDM2, which suggests that SCYL1-BP1 can be regulated by Pirh2.
20505071 Scyl1 participates in the nuclear aminoacylation-dependent tRNA export pathway.
20209057 Scyl1 interacts with 58K/formiminotransferase cyclodeaminase (FTCD) and golgin p115, and is required for the maintenance of Golgi morphology
19958622 TEIF protein and centrosome amplification is commonly found in colorectal tumors. The expression level of TEIF is related to tumor histological grade and malignant degree.
19198626 TEIF functions as a centrosome regulator. Its participation in DNA damage response, including telomere dysfunction and tumorigenesis.
15963946 TEIF could specifically activate transcription of beta-pol promoter, but not that of DNA polymerase alpha or delta promoter. The responsible sequences for binding of TEIF were revealed
15504359 Molecular cloning of telomerase transcriptional elements-interacting factor,(TEIF). TEIF may take part in the transcriptional activation of hTERT.
12036289 NTKL is involved in centrosome-related cellular functions

AA Sequence

MWFFARDPVRDFPFELIPEPPEGGLPGPWALHRGRKKATGSPVSIFVYDVKPGAEEQTQVAKAAFKRFKT      1 - 70
LRHPNILAYIDGLETEKCLHVVTEAVTPLGIYLKARVEAGGLKELEISWGLHQIVKALSFLVNDCSLIHN     71 - 140
NVCMAAVFVDRAGEWKLGGLDYMYSAQGNGGGPPRKGIPELEQYDPPELADSSGRVVREKWSADMWRLGC    141 - 210
LIWEVFNGPLPRAAALRNPGKIPKTLVPHYCELVGANPKVRPNPARFLQNCRAPGGFMSNRFVETNLFLE    211 - 280
EIQIKEPAEKQKFFQELSKSLDAFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKI    281 - 350
IPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLN    351 - 420
EANLNVELMKHFARLQAKDEQGPIRCNTTVCLGKIGSYLSASTRHRVLTSAFSRATRDPFAPSRVAGVLG    421 - 490
FAATHNLYSMNDCAQKILPVLCGLTVDPEKSVRDQAFKAIRSFLSKLESVSEDPTQLEEVEKDVHAASSP    491 - 560
GMGGAAASWAGWAVTGVSSLTSKLIRSHPTTAPTETNIPQRPTPEGVPAPAPTPVPATPTTSGHWETQEE    561 - 630
DKDTAEDSSTADRWDDEDWGSLEQEAESVLAQQDDWSTGGQVSRASQVSNSDHKSSKSPESDWSSWEAEG    631 - 700
SWEQGWQEPSSQEPPPDGTRLASEYNWGGPESSDKGDPFATLSARPSTQPRPDSWGEDNWEGLETDSRQV    701 - 770
KAELARKKREERRREMEAKRAERKVAKGPMKLGARKLD                                    771 - 808
//

Text Mined References (38)

PMID Year Title
26581903 2015 Disruptive SCYL1 Mutations Underlie a Syndrome Characterized by Recurrent Episodes of Liver Failure, Peripheral Neuropathy, Cerebellar Atrophy, and Ataxia.
25575811 2015 Overexpression of N-terminal kinase like gene promotes tumorigenicity of hepatocellular carcinoma by regulating cell cycle progression and cell motility.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24769208 2014 TEIF associated centrosome activity is regulated by EGF/PI3K/Akt signaling.
24481816 2014 Scyl1 scaffolds class II Arfs to specific subcomplexes of coatomer through the ?-COP appendage domain.
24361335 2014 The 58-kda microspherule protein (MSP58) represses human telomerase reverse transcriptase (hTERT) gene expression and cell proliferation by interacting with telomerase transcriptional element-interacting factor (TEIF).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22570270 2012 SCYL1 binding protein 1 promotes the ubiquitin-dependent degradation of Pirh2 and has tumor-suppressive function in the development of hepatocellular carcinoma.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
21269460 2011 Initial characterization of the human central proteome.
20598683 2010 A newly identified Pirh2 substrate SCYL1-BP1 can bind to MDM2 and accelerate MDM2 self-ubiquitination.
20548946 2010 A genome-wide association study of optic disc parameters.
20505071 2010 Scyl1 facilitates nuclear tRNA export in mammalian cells by acting at the nuclear pore complex.
20209057 2010 Scyl1 regulates Golgi morphology.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19958622 2009 [Expression of TEIF protein in colorectal tumors and its correlation with centrosome abnormality].
19946888 2010 Defining the membrane proteome of NK cells.
19198626 2009 Localization of TEIF in the centrosome and its functional association with centrosome amplification in DNA damage, telomere dysfunction and human cancers.
18556652 2008 Scyl1, mutated in a recessive form of spinocerebellar neurodegeneration, regulates COPI-mediated retrograde traffic.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16903783 2006 Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16261899 2005 Expression of a telomerase-associated gene in normal, atrophic, and tumorous testes.
15963946 2005 Transcriptional upregulation of DNA polymerase beta by TEIF.
15504359 2004 Molecular cloning and characterization of a human gene involved in transcriptional regulation of hTERT.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459234 2005 CD93 interacts with the PDZ domain-containing adaptor protein GIPC: implications in the modulation of phagocytosis.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12783284 2003 Cloning and characterization of a novel gene which encodes a protein interacting with the mitosis-associated kinase-like protein NTKL.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036289 2002 Identification and characterization of the human protein kinase-like gene NTKL: mitosis-specific centrosomal localization of an alternatively spliced isoform.
11118629 2000 Cloning and preliminary characterization of a 105 kDa protein with an N-terminal kinase-like domain.
11042159 2000 Normalization and subtraction of cap-trapper-selected cDNAs to prepare full-length cDNA libraries for rapid discovery of new genes.
10843802 2000 Construction of a 350-kb sequence-ready 11q13 cosmid contig encompassing the markers D11S4933 and D11S546: mapping of 11 genes and 3 tumor-associated translocation breakpoints.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.