Property Summary

NCBI Gene PubMed Count 42
PubMed Score 32.88
PubTator Score 90.78

Knowledge Summary

Patent (10,177)

Expression

 GO Function (1)

Gene RIF (19)

PMID Text
26740626 Cysteine trapping identified charge-charge interactions between secretin and secretin receptor residues in TM5, TM6, ECL2, and ECL3 domains.
26397240 Our findings indicate that SCTR suppresses the proliferation of normal breast cells, while the gene stimulates the proliferation and migration of cancer cells being downregulated by promoter methylation.
25241033 High SCTR expression is associated with liver metastases of pancreas neuroendocrine tumors.
23168245 Taken together, we propose here that the down-regulatory effects of NRSF on hSCTR gene expression are mediated via its suppression on Sp1-mediated transactivation.
22964305 Data suggest that the interaction between secretin peptide residue H1 and secretin receptor residue W274 is most compatible with a hydrophobic interaction.
22565418 Results suggest that Secretin is a potent modulator of adipocyte functions, demonstrating overall a role in enhanced substrate cycling.
21851058 binding and activity of a series of 11 truncated and lactam-constrained secretin(5-27) analogues at the prototypic member of this family, the secretin receptor
19904746 results demonstrate that secretin and/or the modulation of SCTR expression might have potential as a therapeutic tool in the treatment of cholangiocarcinoma
19886671 Increasing expression of secretin receptor competes for receptor modifying protein 3 (RAMP3) association with calcitonin receptor-like receptor (CLR) to yield a functional adrenomedullin receptor.
18680717 These results suggest that the secretin receptor can exist only as a structurally-specific homo-dimer, without being present as higher-order oligomers.
18401761 Data show that Family B G-protein-coupled receptor oligomerization occurs, with many structurally related members, such as the secretin receptor,associating with each other.
18223557 secretin receptors are new markers for bronchopulmonary carcinoid tumors
17711922 Secretin-receptor and secretin-receptor-variant expressions occur in all gastrinomas
17678920 A novel abnormal spliceoform of the secretin receptor was identified in pancreatic and bile duct cancers and developed as a dual antibody sandwich enzyme-linked immunosorbent assay for measure in the circulation.
16935383 The high receptor expression in cholangiocarcinomas may be used for in vivo secretin receptor-targeting of these tumors and for the differential diagnosis with hepatocellular carcinoma.
16819820 Secretin receptor oligomerization occurs through -GxxxG- motif-independent interactions of transmembrane segments during the maturation of nascent molecules.
16192632 There is a marked reduction in SCTR binding in ductal neoplasia.
15706223 Secretin receptor transcripts are present in Purkinje cells and basket cells in the molecular cell layer of human cerebellum.
14645499 promoter methylation plays a role in the regulation of SR gene expression.

AA Sequence

MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMW      1 - 70
DNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLL     71 - 140
KLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDA    141 - 210
HRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFL    211 - 280
EDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPL    281 - 350
FGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFS    351 - 420
NSTKASHLEQSQGTCRTSII                                                      421 - 440
//

Text Mined References (43)

PMID Year Title
26740626 2016 Use of Cysteine Trapping to Map Spatial Approximations between Residues Contributing to the Helix N-capping Motif of Secretin and Distinct Residues within Each of the Extracellular Loops of Its Receptor.
26397240 2015 SCTR regulates cell cycle-related genes toward anti-proliferation in normal breast cells while having pro-proliferation activity in breast cancer cells.
25241033 2014 Gene expression accurately distinguishes liver metastases of small bowel and pancreas neuroendocrine tumors.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
23168245 2013 Neuron-restrictive silencer factor functions to suppress Sp1-mediated transactivation of human secretin receptor gene.
22964305 2012 Mapping spatial approximations between the amino terminus of secretin and each of the extracellular loops of its receptor using cysteine trapping.
22565418 2013 Effect of secretin on preadipocyte, differentiating and mature adipocyte functions.
21851058 2011 Lactam constraints provide insights into the receptor-bound conformation of secretin and stabilize a receptor antagonist.
19904746 2010 Secretin inhibits cholangiocarcinoma growth via dysregulation of the cAMP-dependent signaling mechanisms of secretin receptor.
19886671 2009 Molecular basis of association of receptor activity-modifying protein 3 with the family B G protein-coupled secretin receptor.
18680717 2008 Dimerization in the absence of higher-order oligomerization of the G protein-coupled secretin receptor.
18401761 2008 Pattern of intra-family hetero-oligomerization involving the G-protein-coupled secretin receptor.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18223557 2008 Wild-type and splice-variant secretin receptors in lung cancer: overexpression in carcinoid tumors and peritumoral lung tissue.
17711922 2007 Secretin-receptor and secretin-receptor-variant expression in gastrinomas: correlation with clinical and tumoral features and secretin and calcium provocative test results.
17678920 2007 A novel secretin receptor splice variant potentially useful for early diagnosis of pancreatic carcinoma.
16935383 2006 Secretin receptors in the human liver: expression in biliary tract and cholangiocarcinoma, but not in hepatocytes or hepatocellular carcinoma.
16819820 2006 Secretin receptor oligomers form intracellularly during maturation through receptor core domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16192632 2005 Secretin receptors in normal and diseased human pancreas: marked reduction of receptor binding in ductal neoplasia.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15706223 2005 Expression and spatial distribution of secretin and secretin receptor in human cerebellum.
15670850 2005 Calmodulin interacts with the cytoplasmic tails of the parathyroid hormone 1 receptor and a sub-set of class b G-protein coupled receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645499 2004 CpG methylation and transcription factors Sp1 and Sp3 regulate the expression of the human secretin receptor gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11517171 2001 Functional segregation of the highly conserved basic motifs within the third endoloop of the human secretin receptor.
10537138 1999 Role of N-linked glycosylation on the function and expression of the human secretin receptor.
10437774 1999 The human secretin receptor gene: genomic organization and promoter characterization.
9506976 1998 A role for receptor kinases in the regulation of class II G protein-coupled receptors. Phosphorylation and desensitization of the secretin receptor.
9453500 1998 Secretin and vasoactive intestinal peptide receptors: members of a unique family of G protein-coupled receptors.
9440501 1997 Functional antagonism of the human secretin receptor by a recombinant protein encoding the N-terminal ectodomain of the receptor.
8579602 1996 Lysine 173 residue within the first exoloop of rat secretin receptor is involved in carboxylate moiety recognition of Asp 3 in secretin.
8575789 1995 Localization of the gene encoding the secretin receptor, SCTR, on human chromosome 2q14.1 by fluorescence in situ hybridization and chromosome morphometry.
8390245 1993 Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor.
7864894 1995 Molecular cloning and functional expression of a human pancreatic secretin receptor.
7782300 1995 Critical contributions of amino-terminal extracellular domains in agonist binding and activation of secretin and vasoactive intestinal polypeptide receptors. Studies of chimeric receptors.
7700244 1995 Molecular cloning and expression of a human secretin receptor.
7612008 1995 Molecular cloning and functional characterization of a human secretin receptor.
3186683 1988 Secretin receptors in human pancreatic membranes.
1646711 1991 Molecular cloning and expression of a cDNA encoding the secretin receptor.
1335692 1992 Chief cells possess a receptor with high affinity for PACAP and VIP that stimulates pepsinogen release.