Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1165.75
PubTator Score 966.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 3.4e-03
adult high grade glioma -1.400 1.8e-03
atypical teratoid/rhabdoid tumor -1.100 1.7e-03

Gene RIF (19)

PMID Text
23233532 CD36 is a major mediator of FA-induced release of CCK and secretin. These peptides contribute to the role of CD36 in fat absorption and to its pleiotropic metabolic effects.
23064014 a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin
22964305 Data suggest that the interaction between secretin peptide residue H1 and secretin receptor residue W274 is most compatible with a hydrophobic interaction.
21851058 binding and activity of a series of 11 truncated and lactam-constrained secretin(5-27) analogues at the prototypic member of this family, the secretin receptor
21597914 Secretin effect on increase in transcription of the tyrosine hydroxylase (Th) gene and modulate catecholamine secretion, was tested.
20398908 Observational study of gene-disease association. (HuGE Navigator)
19904746 secretin significantly inhibited the tumor size and more than doubled tumor latency, which was associated with a decrease in proliferating cell nuclear antigen and an increase in cleaved-caspase 3 expression levels
19372104 Bile acids inhibit duodenal secretin expression via orphan nuclear receptor small heterodimer partner (SHP).
19239625 secretin acts through stimulation of presynaptic cholinergic neurons in a vagally mediated pathway.
18566919 These results collectively suggest that variable of tandem repeats could potentially be a functional regulator to control the expression of the human secretin gene in different individuals.
18280672 Peptic ulceration may be a hormonal (secfretin) deficiency disease.
16888198 first pathway is by changing the expression levels of nuclear factor-I C(NFI-C) and secretin proteins while the second pathway is by modifying the phosphorylation status of both NFI-C and secretin proteins via cyclin-dependent kinase 1
16888194 small heterodimer partner and secretin are potentially co-expressed and lead us to propose a novel regulatory pathway
15706223 Secretin mRNAs are found in Purkinje cells and secretin-immunoreactivities are localized in both the soma and dendrites of Purkinje cells of human cerebellum.
15610158 Transgenic mouse study suggests a trophic role for secretin on neurons known to be involved in multiple superior functions in the normal brain, and lost in neurodegenerative disorders.
15118068 human secretin gene is controlled by the Sp1/Sp3 transcription factors ratio and the methylation status of the promoter
12160732 fine structure in 11p15.5 and sequence variation in patients with autism
12133828 Human VPAC1 receptor selectivity filter; Identification of a critical domain for restricting binding
11814635 The purpose of this study was to investigate whether secretin exhibits similar properties in vitro by forming micelles in aqueous solution and interacting with phospholipids

AA Sequence

MAPRPLLLLLLLLGGSAARPAPPRARRHSDGTFTSELSRLREGARLQRLLQGLVGKRSEQDAENSMAWTR      1 - 70
LSAGLLCPSGSNMPILQAWMPLDGTWSPWLPPGPMVSEPAGAAAEGTLRPR                        71 - 121
//

Text Mined References (32)

PMID Year Title
25332973 2013 The physiological roles of secretin and its receptor.
23233532 2013 CD36-dependent signaling mediates fatty acid-induced gut release of secretin and cholecystokinin.
23064014 2012 A major lineage of enteroendocrine cells coexpress CCK, secretin, GIP, GLP-1, PYY, and neurotensin but not somatostatin.
22964305 2012 Mapping spatial approximations between the amino terminus of secretin and each of the extracellular loops of its receptor using cysteine trapping.
21851058 2011 Lactam constraints provide insights into the receptor-bound conformation of secretin and stabilize a receptor antagonist.
21597914 2011 Catecholamine biosynthesis and secretion: physiological and pharmacological effects of secretin.
20398908 2010 Comprehensive copy number variant (CNV) analysis of neuronal pathways genes in psychiatric disorders identifies rare variants within patients.
19904746 2010 Secretin inhibits cholangiocarcinoma growth via dysregulation of the cAMP-dependent signaling mechanisms of secretin receptor.
19372104 2009 Bile acids inhibit duodenal secretin expression via orphan nuclear receptor small heterodimer partner (SHP).
19239625 2009 Secretin-induced gastric relaxation is mediated by vasoactive intestinal polypeptide and prostaglandin pathways.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18566919 2008 A functional variable number of tandem repeats is located at the 5' flanking region of the human secretin gene plays a downregulatory role in expression.
18280672 2008 Peptic ulceration may be a hormonal deficiency disease.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16992627 1902 The mechanism of pancreatic secretion.
16888198 2006 Retinoic acid-induced human secretin gene expression in neuronal cells is mediated by cyclin-dependent kinase 1.
16888194 2006 Localization of small heterodimer partner (SHP) and secretin in mouse duodenal cells.
15706223 2005 Expression and spatial distribution of secretin and secretin receptor in human cerebellum.
15610158 2004 Transient expression of secretin in serotoninergic neurons of mouse brain during development.
15118068 2004 Regulation of the human secretin gene is controlled by the combined effects of CpG methylation, Sp1/Sp3 ratio, and the E-box element.
12160732 2002 The human secretin gene: fine structure in 11p15.5 and sequence variation in patients with autism.
12133828 2002 Human VPAC1 receptor selectivity filter. Identification of a critical domain for restricting secretin binding.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
11278902 2001 Marked differences between metalloproteases meprin A and B in substrate and peptide bond specificity.
11060443 2000 Human secretin (SCT): gene structure, chromosome location, and distribution of mRNA.
10807420 2000 Review article: transcriptional events controlling the terminal differentiation of intestinal endocrine cells.
10764961 2000 Secretin, glucagon, gastric inhibitory polypeptide, parathyroid hormone, and related peptides in the regulation of the hypothalamus- pituitary-adrenal axis.
10576771 1999 Co-localization of neuroendocrine hormones in the human fetal pancreas.
9440501 1997 Functional antagonism of the human secretin receptor by a recombinant protein encoding the N-terminal ectodomain of the receptor.
8579602 1996 Lysine 173 residue within the first exoloop of rat secretin receptor is involved in carboxylate moiety recognition of Asp 3 in secretin.
7782300 1995 Critical contributions of amino-terminal extracellular domains in agonist binding and activation of secretin and vasoactive intestinal polypeptide receptors. Studies of chimeric receptors.
2315322 1990 Secretin: structure of the precursor and tissue distribution of the mRNA.