Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.07
PubTator Score 9.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 2.100 4.7e-02
interstitial cystitis -1.100 7.9e-04
lung carcinoma 1.200 7.3e-17
ovarian cancer 1.400 1.9e-04
pancreatic ductal adenocarcinoma liver m... -1.045 1.1e-02
Pick disease -1.100 7.6e-05
progressive supranuclear palsy -1.200 2.2e-02

 GO Function (1)

 GO Process (1)

AA Sequence

MEPFSCDTFVALPPATVDNRIIFGKNSDRLYDEVQEVVYFPAVVHDNLGERLKCTYIEIDQVPETYAVVL      1 - 70
SRPAWLWGAEMGANEHGVCIGNEAVWGREEVCDEEALLGMDLVRLGLERADTAEKALNVIVDLLEKYGQG     71 - 140
GNCTEGRMVFSYHNSFLIADRNEAWILETAGKYWAAEKVQEGVRNISNQLSITTKIAREHPDMRNYAKRK    141 - 210
GWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA    211 - 280
SMVSILPQDSSLPCIHFFTGTPDPERSVFKPFIFVPHISQLLDTSSPTFELEDLVKKKSHFKPDRRHPLY    281 - 350
QKHQQALEVVNNNEEKAKIMLDNMRKLEKELFREMESILQNKHLDVEKIVNLFPQCTKDEIQIYQSNLSV    351 - 420
KVSS                                                                      421 - 424
//

Text Mined References (10)

PMID Year Title