Property Summary

NCBI Gene PubMed Count 68
PubMed Score 54.53
PubTator Score 69.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.700 7.6e-03
posterior fossa group B ependymoma 1.400 8.6e-10
psoriasis 1.100 1.5e-03
tuberculosis 1.100 1.6e-05
pancreatic ductal adenocarcinoma liver m... 1.048 9.8e-03
lung cancer 1.300 1.5e-03
lung adenocarcinoma 1.200 7.5e-08
ovarian cancer 2.400 1.3e-06

Gene RIF (53)

PMID Text
26527679 loss of Scribble-induced HuR translocation mediates the accumulation of Snail via activation of the p38 MAPK pathway.
25734361 The two PDZ domains within the PDZ34 tandem of Scribble, a cell polarity regulator, tightly pack in a 'front-to-back' mode to form a compact supramodule.
24662921 High levels of mislocalized SCRIB functions as a neomorph to promote mammary tumorigenesis.
24527800 miR-296-5p/SCRIB axis plays a role in breast carcinogenesis
24276238 We show that loss of Scrib and activated oncogenic KRas cooperate in vivo, resulting in more aggressive lung tumors
24211266 SHOC2 and MRAS form a complex with SCRIB.
24140112 Haploinsufficiency of each of SCRIB or PUF60 contribute uniquely to specific endophenotypes (e.g., coloboma, heart defects), and binary interaction potentially exacerbates other aspects of the clinical pathology of individuals with 8q24.3 deletion.
23922697 This study demonstrated that rare deleterious mutations of SCRIB may contribute to the multifactorial risk for human spina bifida.
23813956 These data suggests a novel role for Scribble in positively regulating tight junction assembly through transcriptional regulation of an epithelial-to-mesenchymal signaling program.
23774808 Although the Scribble P305L mislocalization mutant can no longer suppress Ras-MAPK-induced invasion or epithelial to mesenchymal transition phenotypes, mislocalized Scribble can still suppress anchorage-independent cell growth.
23730214 CD74-dependent deregulation of the tumor suppressor Scribble in human epithelial and breast cancer cells.
23359326 results demonstrate that hScrib acts as a scaffold to integrate the control of the PP1gamma and ERK signaling pathways and explains how disruption of hScrib localisation can contribute towards the development of human malignancy
22792261 During anoikis, hScrib and hDlg1 have distinct and opposing functions in human keratinocytes.
22179838 NOS1AP colocalizes with both SCRIB and VANGL1 along cellular protrusions in metastatic breast cancer cells, but does not colocalize with either SCRIB or VANGL1 at cell junctions in normal breast cells
22095531 Missense variants in SCRIB may represent a cause of craniorachischisis in humans, as in mice, with defective planar cell polarity protein trafficking to the plasma membrane a likely pathogenic mechanism.
21965329 SCRIB deregulation strongly correlated with poor survival in prostate cancer
21849460 These findings indicate that binding of NS1 to Scribble and Dlg1 functions to disrupt the cellular tight junction and that this effect likely contributes to the severe disease associated with highly pathogenic H5N1 influenza A viruses.
21701506 Knockdown of Scribble (Scrib) results in redistribution of PHLPP1 from the membrane to the cytoplasm and an increase in Akt phosphorylation.
21549346 These data uncover a previously unrecognized exploitation of Scrib for aberrant tumor cell motility and invasion, thus potentially contributing to disease progression in humans.
21489588 HPV16 E6 association with PDZ domain-containing proteins, MAGI1, Dlg1 or Scrib, stabilized the levels of E6.
21086040 single nucleotide polymorphisms in scrib is not associated with breast cancer.
20939435 hScrib is involved in the development of endometrial cancer.
20936341 genetic variability in the SCRIB polarity gene does not contribute to breast cancer development
20936341 Observational study of gene-disease association. (HuGE Navigator)
20702615 one function of the avian NS1 ESEV PBM sequence is to reduce apoptosis during infection through disruption of Scribble's proapoptotic function
20622900 HMGB1 release, as well as its redox state, thus links autophagy and apoptosis, representing a suitable target when coupled with conventional tumor treatments
19959811 Scribble is an important regulator of tight junctions functions and plasticity in the intestinal epithelium.
19555689 Results identify MCC as a potential scaffold protein regulating cell movement and able to bind Scrib, beta-catenin and NHERF1/2.
19386766 The upregulation of vimentin expression during epithelial to mesenchymal transitions may stabilize Scrib to promote directed cell migration.
19041750 Study demonstrates that scribble inhibits breast cancer formation and that deregulation of polarity pathways promotes dysplastic and neoplastic growth in mammals by disrupting morphogenesis and inhibiting cell death.
18716323 data underscore the role of Scrib in cell migration and show the strong impact of Scrib in the function of PAK and Rac, two key molecules implicated in this process
18661220 Tax1 induces aberrant clustering of Scribble, thereby altering the functions in HTLV-1-infected cells.
18641685 Scribble is an important mediator of MAPK signalling and cooperates with H-ras to promote cell invasion.
18513328 Cleavage of Scrib by executioner caspases is a critical step for detachment of cell contact during the process of apoptosis.
18042258 this study demonstrates a novel interaction between TBEV NS5 and the PDZ protein scribble (hScrib) affecting interferon (IFN) type I and II mediated JAK-STAT signalling.
17855372 hDlg and hScrib are both targeted by Tax underlies their importance in T cell function
17509663 Human scribble accumulates in colorectal neoplasia in association with an altered distribution of beta-catenin.
17043654 essential role for mammalian Scribble in the regulation of the polarity specifically involved in directed epithelial migration.
16965391 The association of hScrib with APC would be important for mediating the cell cycle regulations.
16619250 Down-regulation of scrib is associated with colon cancer progression
16611247 Knockdown of hScrib expression by RNAi disrupts localization of adenomatous polyposis coli(APC) at the adherens junction. These data suggest hScrib may participate in the hDlg-APC complex through PDZ domains and regulate cell cycle and neural function
16482544 E6AP is extensively involved in the ubiquitin-mediated degradation of SCRIB (an HPV E6-dependent substrate) as a cellular E3 ubiquitin-protein ligase.
16344308 These results suggest that Scrib stabilizes the coupling between E-cadherin and the catenins and are consistent with the idea that mammalian Scrib could behave as a tumor suppressor by regulating epithelial cell adhesion and migration.
16137684 interacts with TRIP6; binding between two of zyxin's family members and Scrib links Scrib to a communication pathway between cell-cell contacts and the nucleus, and implicates these zyxin family members in Scrib-associated functions
16103886 mapped the binding site of E6 on hScrib and shown that the interaction of E6 with hScrib is distinct from its interactions with other PDZ domain-containing targets
15975580 The direct interaction between hScrib and ZO-2, a junction-associated protein, was reported.
15806148 data establishs a potential link between the E-cadherin and hScrib tumor suppressors
15775968 hScrib directly binds to the G protein-coupled thyroid stimulating hormone receptor (TSHR), inhibits basal receptor endocytosis and promotes recycling, and thus TSHR signalling, at the cell membrane.
15649318 LPP and Scrib proteins localize in cell-cell contacts. This interaction links Scrib to a communication pathway between cell-cell contacts and the nucleus, and implicates LPP in Scrib-associated functions
15261375 May act as a tumor suppressor
14710229 Degradation by human papilloma virus E6 may cause progressive decrease of hScrib expression during disease progression from low-grade squamous intraepithelial lesions (SIL) to high-grade SIL
14681682 hScrib is a functional homologue of DmScrib and therefore predict an important role for hScrib in the suppression of mammalian tumorigenesis
11027293 KIAA0147 encodes the human homolog of Drosophila Scribble. hScrib is targeted for ubiquitin-mediated degradation by the HPV E6 oncoprotein, and mutations in Dros. scrib result in loss of polarity and growth control of epithelial cells.

AA Sequence

MLKCIPLWRCNRHVESVDKRHCSLQAVPEEIYRYSRSLEELLLDANQLRELPKPFFRLLNLRKLGLSDNE      1 - 70
IQRLPPEVANFMQLVELDVSRNDIPEIPESIKFCKALEIADFSGNPLSRLPDGFTQLRSLAHLALNDVSL     71 - 140
QALPGDVGNLANLVTLELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLS    141 - 210
ALPPELGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLRRLPDGIGQLKQLSILKVDQNRLCE    211 - 280
VTEAIGDCENLSELILTENLLMALPRSLGKLTKLTNLNVDRNHLEALPPEIGGCVALSVLSLRDNRLAVL    281 - 350
PPELAHTTELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPMLRFQTEDDARTGEKVLTCYLLPQQP    351 - 420
PPSLEDAGQQGSLSETWSDAPPSRVSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEG    421 - 490
RRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVSEAEPEGPSAEAQGGSQQEATTAGGEEDA    491 - 560
EEDYQEPTVHFAEDALLPGDDREIEEGQPEAPWTLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQ    561 - 630
GMQPDGEGPVAPGGWHNGPHAPWAPRAQKEEEEEEEGSPQEEEVEEEEENRAEEEEASTEEEDKEGAVVS    631 - 700
APSVKGVSFDQANNLLIEPARIEEEELTLTILRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAA    701 - 770
RAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERMVEPENAVTITPLRPEDDYSPRERR    771 - 840
GGGLRLPLLPPESPGPLRQRHVACLARSERGLGFSIAGGKGSTPYRAGDAGIFVSRIAEGGAAHRAGTLQ    841 - 910
VGDRVLSINGVDVTEARHDHAVSLLTAASPTIALLLEREAGGPLPPSPLPHSSPPTAAVATTSITTATPG    911 - 980
VPGLPSLAPSLLAAALEGPYPVEEIRLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARS    981 - 1050
GLRVGDRILAVNGQDVRDATHQEAVSALLRPCLELSLLVRRDPAPPGLRELCIQKAPGERLGISIRGGAR   1051 - 1120
GHAGNPRDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEAVQLLRSVGDTLTVLVCD   1121 - 1190
GFEASTDAALEVSPGVIANPFAAGIGHRNSLESISSIDRELSPEGPGKEKELPGQTLHWGPEATEAAGRG   1191 - 1260
LQPLKLDYRALAAVPSAGSVQRVPSGAAGGKMAESPCSPSGQQPPSPPSPDELPANVKQAYRAFAAVPTS   1261 - 1330
HPPEDAPAQPPTPGPAASPEQLSFRERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKR   1331 - 1400
AQMLREAAEAGAEARLALDGETLGEEEQEDEQPPWASPSPTSRQSPASPPPLGGGAPVRTAKAERRHQER   1401 - 1470
LRVQSPEPPAPERALSPAELRALEAEKRALWRAARMKSLEQDALRAQMVLSRSQEGRGTRGPLERLAEAP   1471 - 1540
SPAPTPSPTPVEDLGPQTSTSPGRLSPDFAEELRSLEPSPSPGPQEEDGEVALVLLGRPSPGAVGPEDVA   1541 - 1610
LCSSRRPVRPGRRGLGPVPS                                                     1611 - 1630
//

Text Mined References (80)

PMID Year Title
26527679 2016 Loss of Scribble Promotes Snail Translation through Translocation of HuR and Enhances Cancer Drug Resistance.
25734361 2015 Interdomain interface-mediated target recognition by the Scribble PDZ34 supramodule.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24662921 2014 Mislocalization of the cell polarity protein scribble promotes mammary tumorigenesis and is associated with basal breast cancer.
24527800 2014 miR-296/Scribble axis is deregulated in human breast cancer and miR-296 restoration reduces tumour growth in vivo.
24276238 2014 Scrib heterozygosity predisposes to lung cancer and cooperates with KRas hyperactivation to accelerate lung cancer progression in vivo.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24211266 2013 An MRAS, SHOC2, and SCRIB complex coordinates ERK pathway activation with polarity and tumorigenic growth.
24140112 2013 SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant.
23922697 2013 Mutations in planar cell polarity gene SCRIB are associated with spina bifida.
23813956 2013 Scribble regulates an EMT polarity pathway through modulation of MAPK-ERK signaling to mediate junction formation.
23774808 2013 Localization, not important in all tumor-suppressing properties: a lesson learnt from scribble.
23730214 2013 CD74-dependent deregulation of the tumor suppressor scribble in human epithelial and breast cancer cells.
23359326 2013 A novel interaction between hScrib and PP1? downregulates ERK signaling and suppresses oncogene-induced cell transformation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22792261 2012 Differential regulation of cell-cell contact, invasion and anoikis by hScrib and hDlg in keratinocytes.
22480440 2012 The PDZ-binding motif of MCC is phosphorylated at position -1 and controls lamellipodia formation in colon epithelial cells.
22179838 2012 A protein complex of SCRIB, NOS1AP and VANGL1 regulates cell polarity and migration, and is associated with breast cancer progression.
22095531 2012 Mutations in the planar cell polarity genes CELSR1 and SCRIB are associated with the severe neural tube defect craniorachischisis.
21965329 2011 SCRIB expression is deregulated in human prostate cancer, and its deficiency in mice promotes prostate neoplasia.
21849460 2011 The avian influenza virus NS1 ESEV PDZ binding motif associates with Dlg1 and Scribble to disrupt cellular tight junctions.
21701506 2011 Scribble-mediated membrane targeting of PHLPP1 is required for its negative regulation of Akt.
21549346 2011 Aberrant overexpression of the cell polarity module scribble in human cancer.
21489588 2011 Stabilization of HPV16 E6 protein by PDZ proteins, and potential implications for genome maintenance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21132015 2011 Protein tyrosine kinase 7 has a conserved role in Wnt/?-catenin canonical signalling.
21086040 2011 No association of polymorphisms in the cell polarity gene SCRIB with breast cancer risk in German population.
20939435 2010 hScrib, a human homolog of Drosophila neoplastic tumor suppressor, is involved in the progress of endometrial cancer.
20936341 2011 No association of polymorphisms in the cell polarity gene SCRIB with breast cancer risk.
20702615 2010 The ESEV PDZ-binding motif of the avian influenza A virus NS1 protein protects infected cells from apoptosis by directly targeting Scribble.
20622900 2010 The cell polarity regulator hScrib controls ERK activation through a KIM site-dependent interaction.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19959811 2010 Tumor suppressor scribble regulates assembly of tight junctions in the intestinal epithelium.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19555689 2009 MCC, a new interacting protein for Scrib, is required for cell migration in epithelial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19386766 2009 Vimentin regulates scribble activity by protecting it from proteasomal degradation.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19041750 2008 Deregulation of scribble promotes mammary tumorigenesis and reveals a role for cell polarity in carcinoma.
18716323 2008 Scrib regulates PAK activity during the cell migration process.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18661220 2008 Human T-cell leukemia virus type 1 Tax induces an aberrant clustering of the tumor suppressor Scribble through the PDZ domain-binding motif dependent and independent interaction.
18641685 2008 Loss of human Scribble cooperates with H-Ras to promote cell invasion through deregulation of MAPK signalling.
18513328 2008 hScrib, a human homologue of Drosophila neoplastic tumor suppressor, is a novel death substrate targeted by caspase during the process of apoptosis.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18042258 2008 Tick-borne encephalitis virus NS5 associates with membrane protein scribble and impairs interferon-stimulated JAK-STAT signalling.
17855372 2007 The PDZ domain-binding motif of the human T cell leukemia virus type 1 tax protein induces mislocalization of the tumor suppressor hScrib in T cells.
17509663 2007 Human scribble accumulates in colorectal neoplasia in association with an altered distribution of beta-catenin.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17043654 2007 The tumour-suppressor Scribble dictates cell polarity during directed epithelial migration: regulation of Rho GTPase recruitment to the leading edge.
16965391 2006 Human homolog of Drosophila tumor suppressor Scribble negatively regulates cell-cycle progression from G1 to S phase by localizing at the basolateral membrane in epithelial cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16619250 2006 Human discs large and scrib are localized at the same regions in colon mucosa and changes in their expression patterns are correlated with loss of tissue architecture during malignant progression.
16611247 2006 Human scribble, a novel tumor suppressor identified as a target of high-risk HPV E6 for ubiquitin-mediated degradation, interacts with adenomatous polyposis coli.
16482544 2006 Involvement of a cellular ubiquitin-protein ligase E6AP in the ubiquitin-mediated degradation of extensive substrates of high-risk human papillomavirus E6.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344308 2005 The mammalian Scribble polarity protein regulates epithelial cell adhesion and migration through E-cadherin.
16137684 2005 The tumor suppressor Scrib selectively interacts with specific members of the zyxin family of proteins.
16103886 2005 The hScrib/Dlg apico-basal control complex is differentially targeted by HPV-16 and HPV-18 E6 proteins.
15975580 2005 hScrib interacts with ZO-2 at the cell-cell junctions of epithelial cells.
15806148 2005 Junctional recruitment of mammalian Scribble relies on E-cadherin engagement.
15775968 2005 Thyrotropin receptor trafficking relies on the hScrib-betaPIX-GIT1-ARF6 pathway.
15649318 2005 The tumor suppressor Scrib interacts with the zyxin-related protein LPP, which shuttles between cell adhesion sites and the nucleus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15261375 2004 [hScrib: a potential novel tumor suppressor].
15231747 2004 A protein interaction framework for human mRNA degradation.
15182672 2004 Mammalian Scribble forms a tight complex with the betaPIX exchange factor.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
14710229 2004 Analysis of the expression and localisation of a LAP protein, human scribble, in the normal and neoplastic epithelium of uterine cervix.
14681682 2003 hScrib is a functional homologue of the Drosophila tumour suppressor Scribble.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11027293 2000 Human scribble (Vartul) is targeted for ubiquitin-mediated degradation by the high-risk papillomavirus E6 proteins and the E6AP ubiquitin-protein ligase.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.