Property Summary

NCBI Gene PubMed Count 14
PubMed Score 6.28
PubTator Score 174.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
Waldenstrons macroglobulinemia -2.150 1.1e-05
chronic lymphocytic leukemia -1.994 3.0e-06
Multiple myeloma 1.034 3.2e-02
astrocytoma 1.500 4.7e-02
glioblastoma 1.200 2.3e-02
medulloblastoma, large-cell -1.400 1.5e-05
juvenile dermatomyositis 1.132 4.4e-08
tuberculosis 1.100 2.8e-05
primary pancreatic ductal adenocarcinoma 1.355 2.8e-03
intraductal papillary-mucinous adenoma (... -1.400 5.5e-03
intraductal papillary-mucinous carcinoma... -1.200 4.1e-02
lung cancer -2.300 3.1e-06
diabetes mellitus -1.200 8.3e-03
subependymal giant cell astrocytoma 2.534 8.0e-03
Breast cancer -1.300 1.7e-06
mucosa-associated lymphoid tissue lympho... 1.172 4.4e-02
ovarian cancer -1.400 2.8e-03
pancreatic cancer 1.200 1.6e-03
dermatomyositis 1.400 9.3e-03

Gene RIF (2)

PMID Text
24530914 The structures of active lysosomal serine carboxypeptidase cathepsin A and the inactive precursor are very similar.
21935400 RACK1 binds to KH-type splicing regulatory protein (KSRP), a member of the Dicer complex, and is required for the recruitment of mature miRNAs to the RNA-induced silencing complex (RISC).

AA Sequence

MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATNSCKNFSELPL      1 - 70
VMWLQGGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGTGFSYVNGSGAYAKDLAMVAS     71 - 140
DMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKCNFAGVALGDSWISPVDSVL    141 - 210
SWGPYLYSMSLLEDKGLAEVSKVAEQVLNAVNKGLYREATELWGKAEMIIEQNTDGVNFYNILTKSTPTS    211 - 280
TMESSLEFTQSHLVCLCQRHVRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVI    281 - 350
SIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKN    351 - 420
LAFYWILKAGHMVPSDQGDMALKMMRLVTQQE                                          421 - 452
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24530914 2014 Crystal structure of cathepsin A, a novel target for the treatment of cardiovascular diseases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21935400 2011 Receptor for activated protein kinase C: requirement for efficient microRNA function and reduced expression in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12754519 2003 Identification and quantification of N-linked glycoproteins using hydrazide chemistry, stable isotope labeling and mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11447226 2001 Cloning of a novel retinoid-inducible serine carboxypeptidase from vascular smooth muscle cells.