Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.68
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

AA Sequence

MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVF      1 - 70
QLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKV     71 - 140
LLSWKLERVFKDWAKF                                                          141 - 156
//

Text Mined References (4)

PMID Year Title