Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.57
PubTator Score 3.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Alzheimer's disease -1.400 4.4e-02
Breast cancer 2.400 3.7e-02
glioblastoma -1.100 4.6e-02
hereditary spastic paraplegia -1.218 7.2e-03
invasive ductal carcinoma 1.200 9.7e-03
lung carcinoma 1.100 1.5e-19
medulloblastoma, large-cell -1.300 1.5e-03
osteosarcoma 3.285 2.6e-06
ovarian cancer -1.500 1.8e-03
Pick disease -1.400 3.7e-03

Gene RIF (5)

AA Sequence

MRRRVFSSQDWRASGWDGMGFFSRRTFCGRSGRSCRGQLVQVSRPEVSAGSLLLPAPQAEDHSSRILYPR      1 - 70
PKSLLPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIE     71 - 140
NLMSASSVFQTTDTKSKRK                                                       141 - 159
//

Text Mined References (16)

PMID Year Title