Property Summary

NCBI Gene PubMed Count 32
PubMed Score 8.72
PubTator Score 19.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 4.3e-54
Disease Target Count Z-score Confidence
Liddle syndrome 14 3.115 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 4.3e-54

 CSPA Cell Line (1)

Gene RIF (22)

PMID Text
25677639 delta-ENaC expression is low in NCI-H441, Calu-3, and ATI cells and does not contribute to transepithelial sodium absorption
22505667 study characterized a new variant, delta2 ENaC, in lung epithelial cells; heterologous delta2betagamma ENaC exhibited a number of divergent features from the delta1betagamma counterpart in biophysics and pharmacology, regulation, and the lifespan of proteins
22159085 delta-ENaC undergoes dynamin-independent endocytosis as opposed to alphabetagamma-channels.
21741370 These results suggest that COMMD1 downregulates deltaENaC activity by reducing deltaENaC surface expression through promoting internalization of surface deltaENaC to an intracellular recycling pool, possibly via enhanced ubiquitination.
21562313 CPT-cGMP Stimulates Human Alveolar Fluid Clearance by Releasing External Na+ Self-Inhibition of ENaC.
21419751 Cpt-cAMP activates human epithelial sodium channels via relieving self-inhibition.
21307123 Identify the specific domains of epithelial sodium channels that are responsible for the differences in the response to flow of alphabetagamma and deltabetagamma channels.
20631247 Data support a physiological role for SGK1.1 in the regulation of delta-ENaC through a pathway that differs from the classical one and suggest that the kinase could serve as an integrator of different signaling pathways converging on the channel.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19717556 the delta-subunit of ENaC alters proteolytic channel activation and enhances base-line channel activity
19359370 Regulation of epithelial sodium channels by cGMP/PKGII.
18951889 ENaCdelta is a candidate molecule for pH sensing in the gastrointestinal system in humans, providing a novel therapeutic target for gastro-oesophageal reflux disease
18298571 EIPA [5-(N-ethyl-N-isopropyl)-amiloride hydrochloride] inhibition of ENaCs, possibly ENaC-alpha and ENaC-delta, significantly improved the sperm motility in healthy donors and in asthenospermia patients.
18073141 Expression analyses at the level of mRNA clearly revealed that ENaC delta transcript was strongly expressed in human melanoma cells using reverse transcription-polymerase chain reaction and cell-based in situ hybridization techniques.
17472699 ENaC delta isoforms are widely expressed in pyramidal cells of the human and monkey cerebral cortex and in different neuronal populations of telencephalic subcortical nuclei.
16930535 analysis of anovel spliced variant of the ENaC delta-subunit in the human brain
16423824 the interactions of delta-ENaC with alpha beta gamma-human epithelial sodium channel subunits could account for heterogeneity of native epithelial channels
15308635 ENaCdelta is chemically activated by capsazepine by a proton-dependent mechanism
15084585 delta ENaC is a proton sensor
14726523 ENaCdelta activity is regulated by protons, and may contribute to the pH sensation and/or pH regulation in the human brain
14645214 delta ENaC is regulated by Murr1

AA Sequence

MAEHRSMDGRMEAATRGGSHLQAAAQTPPRPGPPSAPPPPPKEGHQEGLVELPASFRELLTFFCTNATIH      1 - 70
GAIRLVCSRGNRLKTTSWGLLSLGALVALCWQLGLLFERHWHRPVLMAVSVHSERKLLPLVTLCDGNPRR     71 - 140
PSPVLRHLELLDEFARENIDSLYNVNLSKGRAALSATVPRHEPPFHLDREIRLQRLSHSGSRVRVGFRLC    141 - 210
NSTGGDCFYRGYTSGVAAVQDWYHFHYVDILALLPAAWEDSHGSQDGHFVLSCSYDGLDCQARQFRTFHH    211 - 280
PTYGSCYTVDGVWTAQRPGITHGVGLVLRVEQQPHLPLLSTLAGIRVMVHGRNHTPFLGHHSFSVRPGTE    281 - 350
ATISIREDEVHRLGSPYGHCTAGGEGVEVELLHNTSYTRQACLVSCFQQLMVETCSCGYYLHPLPAGAEY    351 - 420
CSSARHPAWGHCFYRLYQDLETHRLPCTSRCPRPCRESAFKLSTGTSRWPSAKSAGWTLATLGEQGLPHQ    421 - 490
SHRQRSSLAKINIVYQELNYRSVEEAPVYSVPQLLSAMGSLCSLWFGASVLSLLELLELLLDASALTLVL    491 - 560
GGRRLRRAWFSWPRASPASGASSIKPEASQMPPPAGGTSDDPEPSGPHLPRVMLPGVLAGVSAEESWAGP    561 - 630
QPLETLDT                                                                  631 - 638
//

Text Mined References (32)

PMID Year Title
26772908 2016 Epithelial sodium channel (ENaC) family: Phylogeny, structure-function, tissue distribution, and associated inherited diseases.
25677639 2015 Expression and function of the epithelial sodium channel ?-subunit in human respiratory epithelial cells in vitro.
22505667 2012 Characterization of a novel splice variant of ? ENaC subunit in human lungs.
22159085 2012 Differential N termini in epithelial Na+ channel ?-subunit isoforms modulate channel trafficking to the membrane.
21741370 2011 COMMD1 regulates the delta epithelial sodium channel (?ENaC) through trafficking and ubiquitination.
21562313 2011 8-(4-chlorophenylthio)-guanosine-3',5'-cyclic monophosphate-Na stimulates human alveolar fluid clearance by releasing external Na+ self-inhibition of epithelial Na+ channels.
21419751 2011 Cpt-cAMP activates human epithelial sodium channels via relieving self-inhibition.
21307123 2011 Second transmembrane domain modulates epithelial sodium channel gating in response to shear stress.
20631247 2010 The neuronal-specific SGK1.1 kinase regulates {delta}-epithelial Na+ channel independently of PY motifs and couples it to phospholipase C signaling.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19812697 2009 Sour ageusia in two individuals implicates ion channels of the ASIC and PKD families in human sour taste perception at the anterior tongue.
19717556 2009 The delta-subunit of the epithelial sodium channel (ENaC) enhances channel activity and alters proteolytic ENaC activation.
19520916 2010 Characterization of the epithelial sodium channel delta-subunit in human nasal epithelium.
19359370 2009 Regulation of epithelial sodium channels by cGMP/PKGII.
18951889 2008 Epithelial Na+ channel delta subunit is an acid sensor in the human oesophagus.
18298571 2009 Blockade of epithelial sodium channels improves sperm motility in asthenospermia patients.
18073141 2008 Expression analysis of the epithelial Na+ channel delta subunit in human melanoma G-361 cells.
17472699 2007 Cloning and functional expression of a new epithelial sodium channel delta subunit isoform differentially expressed in neurons of the human and monkey telencephalon.
16930535 2006 A novel spliced variant of the epithelial Na+ channel delta-subunit in the human brain.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16423824 2006 Delta-subunit confers novel biophysical features to alpha beta gamma-human epithelial sodium channel (ENaC) via a physical interaction.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308635 2004 Capsazepine is a novel activator of the delta subunit of the human epithelial Na+ channel.
15084585 2004 Degenerin sites mediate proton activation of deltabetagamma-epithelial sodium channel.
14726523 2004 Protons activate the delta-subunit of the epithelial Na+ channel in humans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645214 2004 Identification of Murr1 as a regulator of the human delta epithelial sodium channel.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8661065 1996 Assignment of the human amiloride-sensitive Na+ channel delta isoform to chromosome 1p36.3-p36.2.
7499195 1995 Molecular cloning and functional expression of a novel amiloride-sensitive Na+ channel.