Property Summary

NCBI Gene PubMed Count 20
PubMed Score 13.03
PubTator Score 10.93

Knowledge Summary

Patent (666)

Expression

  Differential Expression (21)

Gene RIF (16)

PMID Text
26182346 Human Nav1.6 channels generate larger resurgent currents than human Nav1.1 channels, but the SCN4B-derived Navbeta4 peptide does not protect either isoform from use-dependent reduction.
26179811 Contribution of Cardiac Sodium Channel beta-Subunit Variants to Brugada Syndrome.
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
25450227 The expression of a human-specific isoform of the voltage-gated sodium channel subunit SCN4B was significantly correlated to lifetime alcohol consumption
24297919 results suggest the presence of a docking site that is maintained by a cysteine bridge buried within the hydrophobic core of beta4.
23604097 this is the first study to demonstrate an association of SCN4B mutations with AF, suggesting SCN4B as a novel AF susceptibility gene.
22842345 SCN5A-SCN4B were found to be essential for positive selection of CD4(+) T cells.
21115638 The paroxysmal extreme pain disorder associated Nav1.7 missense mutations M1627K, T1464I and V1299F increase Navbeta4 peptide-mediated resurgent sodium currents, in contrast to the erythromelalgia associated I848T and L858H Nav1.7 missense mutations.
21051419 Observational study of gene-disease association. (HuGE Navigator)
20226894 The researchers found evidence of an association between SCN4B subunit mutations and sudden infant death syndrome pathogenesis.
20226894 Observational study of gene-disease association. (HuGE Navigator)
19808477 Observational study of gene-disease association. (HuGE Navigator)
19808477 Loss of function mutations in sodium channel beta-subunits were identified in patients with atrial fibrillation and were associated with a distinctive ECG phenotype
18941776 Co-expression of the beta1 subunit impeded slow inactivation elicited by a 30-s depolarization, such that the voltage dependence was right shifted (depolarized) and recovery was hastened.
17592081 SCN4B is a long QT syndrome susceptibility gene.
12930796 molecular cloning and characterization of sodium channel beta4

AA Sequence

MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFGFEDLHFRWTY      1 - 70
NSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRDLEFSDTGKYTCHVKNPKENN     71 - 140
LQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILILLIKKLIIFILKKTREKKKECLVSSSGNDN    141 - 210
TENGLPGSKAEEKPPSKV                                                        211 - 228
//

Text Mined References (20)

PMID Year Title
26182346 2015 Human Nav1.6 Channels Generate Larger Resurgent Currents than Human Nav1.1 Channels, but the Nav?4 Peptide Does Not Protect Either Isoform from Use-Dependent Reduction.
26179811 2015 Contribution of Cardiac Sodium Channel ?-Subunit Variants to Brugada Syndrome.
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
25450227 2015 Transcriptome organization for chronic alcohol abuse in human brain.
24297919 2013 Crystallographic insights into sodium-channel modulation by the ?4 subunit.
23604097 2013 Mutations of the SCN4B-encoded sodium channel ?4 subunit in familial atrial fibrillation.
22842345 2012 A voltage-gated sodium channel is essential for the positive selection of CD4(+) T cells.
21115638 2011 Nav1.7 mutations associated with paroxysmal extreme pain disorder, but not erythromelalgia, enhance Navbeta4 peptide-mediated resurgent sodium currents.
21051419 2011 Mutations in sodium channel ?-subunit SCN3B are associated with early-onset lone atrial fibrillation.
20226894 2010 Sudden infant death syndrome-associated mutations in the sodium channel beta subunits.
19808477 2009 Mutations in sodium channel ?1- and ?2-subunits associated with atrial fibrillation.
18941776 2009 Slow inactivation of the NaV1.4 sodium channel in mammalian cells is impeded by co-expression of the beta1 subunit.
17592081 2007 SCN4B-encoded sodium channel beta4 subunit in congenital long-QT syndrome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12930796 2003 Sodium channel beta4, a new disulfide-linked auxiliary subunit with similarity to beta2.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
1293796 1992 [Idiopathic thrombocytopenic purpura: present knowledge and future expectations].