Property Summary

NCBI Gene PubMed Count 35
PubMed Score 10.52
PubTator Score 7.02

Knowledge Summary

Patent (692)

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -3.100 2.3e-04
astrocytic glioma -2.400 2.7e-03
Astrocytoma, Pilocytic -4.400 5.7e-10
atypical teratoid / rhabdoid tumor -4.800 5.6e-09
ependymoma -4.800 1.2e-23
glioblastoma -3.300 5.1e-08
lung cancer 1.600 3.2e-03
lung carcinoma 2.000 5.8e-28
medulloblastoma -2.100 2.5e-03
medulloblastoma, large-cell -3.100 3.8e-03
oligodendroglioma -2.000 1.7e-09
osteosarcoma 1.467 3.6e-03
ovarian cancer -1.200 3.0e-06
Pick disease -2.300 6.4e-03
pituitary cancer 1.400 6.7e-04
psoriasis -1.200 9.9e-03

Synonym

Accession Q9NY72 A5H1I5 Q17RL3 Q9ULR2
Symbols SCNB3
ATFB16
BRGDA7
HSA243396

Gene

Gene RIF (18)

AA Sequence

MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGK      1 - 70
DFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRL     71 - 140
IPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYCYRKVSKAEEAAQENASDYLAIPSENKENSA    141 - 210
VPVEE                                                                     211 - 215
//

Text Mined References (36)

PMID Year Title