Property Summary

NCBI Gene PubMed Count 23
PubMed Score 15.31
PubTator Score 10.74

Knowledge Summary

Patent (1,912)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -3.000 1.8e-03
ependymoma -4.400 9.6e-19
oligodendroglioma -2.200 1.6e-02
glioblastoma -5.300 3.9e-07
medulloblastoma -5.100 1.3e-10
atypical teratoid / rhabdoid tumor -5.700 5.8e-12
medulloblastoma, large-cell -5.600 6.4e-09
primitive neuroectodermal tumor -5.200 1.6e-06
pediatric high grade glioma -4.400 6.3e-09
pilocytic astrocytoma -3.000 8.1e-10
subependymal giant cell astrocytoma -2.641 1.6e-02
lung adenocarcinoma -1.100 6.3e-08
Breast cancer -2.600 1.3e-08
Pick disease -1.500 3.4e-02
pituitary cancer 2.600 8.6e-06

 CSPA Cell Line (1)

Gene RIF (10)

PMID Text
26894959 The authors identified a flexible loop formed by (72)Cys and (75)Cys, a unique feature among the four beta-subunit isoforms.
26179811 Contribution of Cardiac Sodium Channel beta-Subunit Variants to Brugada Syndrome.
25757662 In a nonreferred nationwide Danish cohort of SIDS cases, up to 5/66 (7.5%) of SIDS cases can be explained by genetic variants in the sodium channel complex genes.
24892658 With increased beta-2 expression, prostate cancer cells display a trend of enhanced association with nerve axons.
24337656 sodium channel polymorphisms are associated with epilepsy
23559163 SCN2B is a new candidate gene associated with Brugada syndrome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20226894 Observational study of gene-disease association. (HuGE Navigator)
19808477 Observational study of gene-disease association. (HuGE Navigator)
15833746 beta2 is a PS/gamma-secretase substrate, gamma-secretase mediated cleavage of beta2-C-terminal fragment is required for cell-cell adhesion and migration of beta2-expressing cells

AA Sequence

MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQ      1 - 70
ECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHG     71 - 140
KIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNP    141 - 210
DDGAK                                                                     211 - 215
//

Text Mined References (23)

PMID Year Title
26894959 2016 Binary architecture of the Nav1.2-?2 signaling complex.
26179811 2015 Contribution of Cardiac Sodium Channel ?-Subunit Variants to Brugada Syndrome.
25757662 2015 The role of the sodium current complex in a nonreferred nationwide cohort of sudden infant death syndrome.
24892658 2014 Identification of beta-2 as a key cell adhesion molecule in PCa cell neurotropic behavior: a novel ex vivo and biophysical approach.
24337656 2014 Case-control association study of polymorphisms in the voltage-gated sodium channel genes SCN1A, SCN2A, SCN3A, SCN1B, and SCN2B and epilepsy.
23559163 2013 A missense mutation in the sodium channel ?2 subunit reveals SCN2B as a new candidate gene for Brugada syndrome.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22992729 2012 Identification of the cysteine residue responsible for disulfide linkage of Na+ channel ? and ?2 subunits.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20226894 2010 Sudden infant death syndrome-associated mutations in the sodium channel beta subunits.
19808477 2009 Mutations in sodium channel ?1- and ?2-subunits associated with atrial fibrillation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15833746 2005 Presenilin/gamma-secretase-mediated cleavage of the voltage-gated sodium channel beta2-subunit regulates cell adhesion and migration.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10198179 1999 Evolution and diversity of mammalian sodium channel genes.
9887383 Exclusion of the SCN2B gene as candidate for CMT4B.
9295116 1997 Structure and chromosomal localization of the beta2 subunit of the human brain sodium channel.
8521473 1995 Structure and function of the beta 2 subunit of brain sodium channels, a transmembrane glycoprotein with a CAM motif.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
6319405 1984 The sodium channel from rat brain. Purification and subunit composition.