Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.07
PubTator Score 2.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Embryonal carcinoma 11 3.002 1.5

Expression

 GWAS Trait (1)

Protein-protein Interaction (9)

Gene RIF (2)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPR      1 - 70
NTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFL     71 - 140
LKTLNGAEMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGSEVLVTFDGWRGAFDY    141 - 210
WCRFDSRDIFPVGWCSLTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRKPGKK    211 - 280
RGRTPKTLISHPISAPSKTAEPLKFPKKRGPKPGSKRKPRTLLNPPPASPTTSTPEPDTSTVPQDAATIP    281 - 350
SSAMQAPTVCIYLNKNGSTGPHLDKKKVQQLPDHFGPARASVVLQQAVQACIDCAYHQKTVFSFLKQGHG    351 - 420
GEVISAVFDREQHTLNLPAVNSITYVLRFLEKLCHNLRSDNLFGNQPFTQTHLSLTAIEYSHSHDRYLPG    421 - 490
ETFVLGNSLARSLEPHSDSMDSASNPTNLVSTSQRHRPLLSSCGLPPSTASAVRRLCSRGVLKGSNERRD    491 - 560
MESFWKLNRSPGSDRYLESRDASRLSGRDPSSWTVEDVMQFVREADPQLGPHADLFRKHEIDGKALLLLR    561 - 630
SDMMMKYMGLKLGPALKLSYHIDRLKQGKF                                            631 - 660
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18391952 2008 Genome-wide association analysis identifies 20 loci that influence adult height.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14973489 2004 The cell-cycle regulator geminin inhibits Hox function through direct and polycomb-mediated interactions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12167701 2002 The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans.
10653359 1999 A novel member of murine Polycomb-group proteins, Sex comb on midleg homolog protein, is highly conserved, and interacts with RAE28/mph1 in vitro.
10524249 1999 The human homolog of Sex comb on midleg (SCMH1) maps to chromosome 1p34.