Property Summary

NCBI Gene PubMed Count 10
PubMed Score 312.50
PubTator Score 57.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 2.800 1.2e-05
malignant mesothelioma 1.200 2.2e-04

Gene RIF (5)

AA Sequence

MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRK      1 - 70
AKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVKGAKPHFIT     71 - 140
SSVEHDSIRLPLEHLVEEQVAAVTFVPVSKVSGQAEVDDILAAVRPTTRLVTIMLANNETGIVMPVPEIS    141 - 210
QRIKALNQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPRIGALYIRGLGEFTPLY    211 - 280
PMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHLNSQFP    281 - 350
GTQRLPNTCNFSIRGPRLQGHVVLAQCRVLMASVGAACHSDHGDQPSPVLLSYGVPFDVARNALRLSVGR    351 - 420
STTRAEVDLVVQDLKQAVAQLEDQA                                                 421 - 445
//

Text Mined References (18)

PMID Year Title