Property Summary

NCBI Gene PubMed Count 24
PubMed Score 28.83
PubTator Score 24.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma, large-cell 1.100 4.6e-04
non-small cell lung cancer -3.623 2.5e-10
lung adenocarcinoma -2.500 8.9e-05
lung carcinoma -5.300 1.5e-23
spina bifida -1.622 4.3e-02
psoriasis -1.100 3.3e-18

Synonym

Accession Q96PL1
Symbols LU103
PNSP1
UGRP1
pnSP-1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (19)

PMID Text
23934357 This meta-analysis suggests that SCGB3A2 polymorphism at positions -112G>A was associated with Graves' disease both in Chinese and Caucasian population.
21410962 This study documents the association between polymorphisms in UGRP1 and the common cold, suggesting a potential role in its pathogenesis.
21385388 Reduced production of UGRP1, which is likely due, at least in part, to a local cytokine environment, may contribute to the hyper-inflammation in chronic rhinosinusitis and correlates with response to surgery.
21170691 the SCGB3A2 -112G >A polymorphism may be considered as a likely marker linking susceptibility to allergy/asthma and Graves' disease
20843168 pattern of UGRP-1 concentration resembled that of Clara cell protein, both proteins occurring in high concentrations in amniotic fluid, sputum and BALF and in much lower concentrations in serum and urine
20466451 Results demonstrate that SCGB3A2 is a useful marker for diagnosis of pulmonary tumors both in mice and humans.
20210668 association was detected between SCGB3A2 and U.K. Caucasian Graves' disease subjects but the size of effect was smaller than that seen in the Oriental population (odds ratio = 1.28-1.73).
20210668 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19126779 SCGB3A2 gene may contribute to Graves' disease susceptibility.
19126779 Observational study of gene-disease association. (HuGE Navigator)
18201431 results suggest that the -112G/A polymorphism does not play a significant role in the genetic predisposition of the UGRP1 gene in atopic asthma in the Sicilian population
18089940 plasma UGRP1 levels were associated with the G-112A UGRP1 gene promoter polymorphism and the severity of asthma
18089940 Observational study of gene-disease association. (HuGE Navigator)
16195814 Observational study of gene-disease association. (HuGE Navigator)
15591807 Observational study of gene-disease association. (HuGE Navigator)
15485815 results demonstrate that interleukin-10 induces uteroglobin related protein 1(UGRP1) gene expression in lung epithelial cells through transcription factor T/EBP/NKX2.1-dependent pathway
12847263 By in situ hybridization, UGRP1 is found to be expressed by lung Clara-like cells in the bronchial epithelium and up-regulated in lung epithelium of a patient with cystic fibrosis.
11813133 polymorphism in the human UGRP1 gene promoter that regulates transcription is associated with an increased risk of asthma

AA Sequence

MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKC      1 - 70
VNELGPEASEAVKKLLEALSHLV                                                    71 - 93
//

Text Mined References (25)

PMID Year Title
23934357 2014 The association of SCGB3A2 polymorphisms with the risk of Graves' disease: a meta-analysis.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
21410962 2011 Variation in Uteroglobin-Related Protein 1 (UGRP1) gene is associated with allergic rhinitis in Singapore Chinese.
21385388 2011 The cytokine-driven regulation of secretoglobins in normal human upper airway and their expression, particularly that of uteroglobin-related protein 1, in chronic rhinosinusitis.
21170691 2011 The -112G>A polymorphism of the secretoglobin 3A2 (SCGB3A2) gene encoding uteroglobin-related protein 1 (UGRP1) increases risk for the development of Graves' disease in subsets of patients with elevated levels of immunoglobulin E.
20843168 2010 Development of a new sensitive ELISA for the determination of uteroglobin-related protein 1, a new potential biomarker.
20466451 2011 Secretoglobin 3A2/uteroglobin-related protein 1 is a novel marker for pulmonary carcinoma in mice and humans.
20210668 2010 Confirmation of association of chromosome 5q31-33 with United Kingdom Caucasian Graves' disease.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19126779 2009 Functional SNPs in the SCGB3A2 promoter are associated with susceptibility to Graves' disease.
18201431 Uteroglobin-related protein 1 gene -112G/a polymorphism and atopic asthma in Sicilian children.
18089940 2008 Plasma UGRP1 levels associate with promoter G-112A polymorphism and the severity of asthma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16195814 2005 Association study between the IL4, IL13, IRF1 and UGRP1 genes in chromosomal 5q31 region and Chinese Graves' disease.
15591807 2005 Uteroglobin-related protein 1(UGRP1) gene polymorphisms and atopic asthma in the Indian population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485815 2004 Interleukin-10 induces uteroglobin-related protein (UGRP) 1 gene expression in lung epithelial cells through homeodomain transcription factor T/EBP/NKX2.1.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12847263 2003 Identification of uteroglobin-related protein 1 and macrophage scavenger receptor with collagenous structure as a lung-specific ligand-receptor pair.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175512 2002 Expression of high in normal-1 (HIN-1) and uteroglobin related protein-1 (UGRP-1) in adult and developing tissues.
11813133 2002 A polymorphism in the human UGRP1 gene promoter that regulates transcription is associated with an increased risk of asthma.
11682631 2001 UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor.
10949149 2000 Human bronchoalveolar lavage fluid protein two-dimensional database: study of interstitial lung diseases.
8557195 1996 The T/ebp null mouse: thyroid-specific enhancer-binding protein is essential for the organogenesis of the thyroid, lung, ventral forebrain, and pituitary.