Property Summary

NCBI Gene PubMed Count 24
PubMed Score 30.36
PubTator Score 24.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Asthma 385 3.882 1.9
Disease Target Count P-value
lung carcinoma 2843 1.5e-23
psoriasis 6694 3.3e-18
non-small cell lung cancer 2890 2.5e-10
medulloblastoma, large-cell 6241 4.6e-04
lung adenocarcinoma 2716 3.8e-02
spina bifida 1074 4.3e-02
Disease Target Count Z-score Confidence
Graves' disease 24 3.539 1.8
Disease Target Count
Asthma, susceptibility to 11

Expression

  Differential Expression (6)

Disease log2 FC p
lung adenocarcinoma -1.100 3.8e-02
lung carcinoma -5.300 1.5e-23
medulloblastoma, large-cell 1.100 4.6e-04
non-small cell lung cancer -3.623 2.5e-10
psoriasis -1.100 3.3e-18
spina bifida -1.622 4.3e-02

Gene RIF (19)

AA Sequence

MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKC      1 - 70
VNELGPEASEAVKKLLEALSHLV                                                    71 - 93
//

Text Mined References (27)

PMID Year Title