Property Summary

NCBI Gene PubMed Count 39
PubMed Score 28.57
PubTator Score 34.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
primary pancreatic ductal adenocarcinoma -1.155 9.4e-03
non-small cell lung cancer -3.201 1.8e-11
intraductal papillary-mucinous adenoma (... -2.200 3.1e-03
intraductal papillary-mucinous carcinoma... -1.900 3.8e-02
intraductal papillary-mucinous neoplasm ... -2.400 3.1e-03
cystic fibrosis -2.700 1.4e-06
invasive ductal carcinoma -1.725 1.9e-02
lung carcinoma -1.400 1.3e-05
breast carcinoma -2.000 8.1e-12
Breast cancer -2.100 1.7e-05
pituitary cancer -1.100 1.9e-02
psoriasis -2.600 2.1e-21

Gene RIF (27)

PMID Text
26370119 Tumor-adjacent tissues showed higher methylation status of RASSF1A, HIN-1 and MGMT promoters.
24850174 aberrant HIN-1 promoter methylation could be an independent and important biomarker used in predicting the prognosis and progression of breast cancer
24710847 SCGB3A1-183 T and SCGB3A1 IVS1-189 A alleles might have a protective effect against nasal polyposis.
22871047 Methylation of HIN-1 promoter is a novel epigenetic biomarker associated with poor outcomes in OCCA patients.
22695491 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancers was associated with clinical characteristics, but only RASSF1A methylation was associated with time to first recurrence and overall survival.
22095135 analysis of AKT signaling pathway activated by HIN-1 methylation in non-small cell lung cancer
22048254 HIN1, was the most "dietary sensitive" genes, as methylation of their promoters was associated with intakes of at least two out of the eight dietary methyl factors examined.
21812955 Data show that SCGB3A1 was down-regulated in invasive compared with DCIS, whereas talin 2 (TLN2) and PTGS1 were up-regulated in invasive compared with DCIS.
21274384 Data suggest that high methylation of the HIN-1 promoter results in silenced HIN-1 expression in gastric cancer, and that 5-aza-2'-deoxycytidine reverses HIN-1 methylation and reduces viability of gastric cancer cells.
20642860 Hypermethylation of HIN-1 is associated with lymphatic metastasis of breast cancers.
20505321 The methylation levels and frequencies of HIN1, RASSF1A and TWIST, and average MR were significantly lower in basal-like subtype compared to luminal or human epithelial growth factor receptor-2 subtype.
20496080 HIN-1, RAR-beta, RASSF1A, and Twist had the ability to distinguish high-grade squamous intraepithelial lesions/squamous cell carcinomas from low-grade squamous intraepithelial lesions/negative cervical scrapings
19509163 The epigenetic silencing of tumor suppressor genes involved in the Ras/PI3K/AKT pathway plays an important role in oral squamous cell carcinoma radioresistance
19470737 Results show that cumulative RASSF1A, TWIST1, and HIN1 gene methylation accurately distinguished ducts with cancerous versus benign lesions.
19258476 The combination of RARB M4, INK4a/ARF, PRB, and HIN-1 CpG island promoter methylation may predict non-BRCA1/2-associated mammary carcinogenesis and tumor progression.
19098448 HIN-1 silencing is associated with dense promoter region hypermethylation in esophageal cancer and suggest that methylation of HIN-1 is an early event in dysplastic transformation.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18483325 HIN-1 was strongly associated with breast cytologic atypia. HIN-1 methylation increased rapidly between ages 32 and 40.
17623056 DNA hypermethylation of tumour suppressor genes seems to play an important role in ovarian carcinogenesis and HOXA9, HOXB5, SCGB3A1, and CRABP1 are identified as novel hypermethylated target genes in this tumour type
17545522 CASP8, DCR2, and HIN-1 methylation leads to progression of neuroblastoma
16266985 Studies provide further evidence that HIN-1 possesses tumor suppressor functions, and that these activities may be mediated through the AKT signaling pathway.
15472908 Aberrant methylation of HIN-1 is a frequent event in many human malignancies
15383627 silencing of HIN-1 expression and methylation of its promoter occurs in multiple human cancer types, suggesting that elimination of HIN-1 function may contribute to several forms of epithelial tumorigenesis
14977834 high in normal-1 (HIN-1) is downregulated in stage I non-small cell lung cancer
14614327 Lack of HIN-1 methylation defines specific breast tumor subtypes including medullary carcinoma of the breast and BRCA1-linked tumors
14601057 hypermethylated in invasive and in in situ lobular breast cancer
12727813 Sporadic breast tumors with a "BRCA1-like" histopathological phenotype also demonstrated significantly lower frequency of HIN-1 promoter methylation.

AA Sequence

MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNH      1 - 70
LIEGSQKCVAELGPQAVGAVKALKALLGALTVFG                                         71 - 104
//

Text Mined References (40)

PMID Year Title
26370119 2015 Applicability of HIN-1, MGMT and RASSF1A promoter methylation as biomarkers for detecting field cancerization in breast cancer.
24850174 2014 Aberrant promoter methylation of HIN-1 gene may contribute to the pathogenesis of breast cancer: a meta-analysis.
24710847 2014 Investigation of SCGB3A1 (UGRP2) gene arrays in patients with nasal polyposis.
22871047 2012 Promoter methylation status of HIN-1 associated with outcomes of ovarian clear cell adenocarcinoma.
22695491 2012 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
22095135 2012 AKT signaling pathway activated by HIN-1 methylation in non-small cell lung cancer.
22048254 2011 The influence of one-carbon metabolism on gene promoter methylation in a population-based breast cancer study.
21812955 2011 Serum estradiol levels associated with specific gene expression patterns in normal breast tissue and in breast carcinomas.
21274384 2011 Silence of HIN-1 expression through methylation of its gene promoter in gastric cancer.
20642860 2010 Tumor suppressor genes are frequently methylated in lymph node metastases of breast cancers.
20505321 2010 Basal-like breast cancer displays distinct patterns of promoter methylation.
20496080 2010 Quantitative assessment of DNA methylation for the detection of cervical neoplasia in liquid-based cytology specimens.
19509163 2009 Methylation of RASSF1A, RASSF2A, and HIN-1 is associated with poor outcome after radiotherapy, but not surgery, in oral squamous cell carcinoma.
19470737 2009 Hypermethylated genes as biomarkers of cancer in women with pathologic nipple discharge.
19258476 2009 CpG island tumor suppressor promoter methylation in non-BRCA-associated early mammary carcinogenesis.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19098448 2008 Promoter methylation of HIN-1 in the progression to esophageal squamous cancer.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18483325 2008 DNA methylation in benign breast epithelium in relation to age and breast cancer risk.
17623056 2007 DNA methylation profiling of ovarian carcinomas and their in vitro models identifies HOXA9, HOXB5, SCGB3A1, and CRABP1 as novel targets.
17545522 2007 Methylation of CASP8, DCR2, and HIN-1 in neuroblastoma is associated with poor outcome.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16266985 2005 HIN-1, an inhibitor of cell growth, invasion, and AKT activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15472908 2005 Aberrant methylation of HIN-1 (high in normal-1) is a frequent event in many human malignancies.
15383627 2004 Frequent HIN-1 promoter methylation and lack of expression in multiple human tumor types.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14977834 2004 Down regulation of high in normal-1 (HIN-1) is a frequent event in stage I non-small cell lung cancer and correlates with poor clinical outcome.
14614327 Lack of HIN-1 methylation defines specific breast tumor subtypes including medullary carcinoma of the breast and BRCA1-linked tumors.
14601057 2003 DNA methylation of RASSF1A, HIN-1, RAR-beta, Cyclin D2 and Twist in in situ and invasive lobular breast carcinoma.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12847263 2003 Identification of uteroglobin-related protein 1 and macrophage scavenger receptor with collagenous structure as a lung-specific ligand-receptor pair.
12727813 2003 Lack of HIN-1 methylation in BRCA1-linked and "BRCA1-like" breast tumors.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438750 2002 Cloning, expression, and chromosomal localization of the mouse gene (Scgb3a1, alias Ugrp2) that encodes a member of the novel uteroglobin-related protein gene family.
12406855 2002 Secretoglobins SCGB3A1 and SCGB3A2 define secretory cell subsets in mouse and human airways.
12175512 2002 Expression of high in normal-1 (HIN-1) and uteroglobin related protein-1 (UGRP-1) in adult and developing tissues.
11682631 2001 UGRP1, a uteroglobin/Clara cell secretory protein-related protein, is a novel lung-enriched downstream target gene for the T/EBP/NKX2.1 homeodomain transcription factor.
11481438 2001 HIN-1, a putative cytokine highly expressed in normal but not cancerous mammary epithelial cells.