Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

 GO Component (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (2)

AA Sequence

MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCR      1 - 70
DGLQPMHKAELVKLLVQVLGSQDGA                                                  71 - 95
//

Text Mined References (3)

PMID Year Title