Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession P0DMR2
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG

 GO Component (1)

 Compartment GO Term (0)

 HCA RNA Cell Line (2)

AA Sequence

MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAKAAMTELKSCR      1 - 70
DGLQPMHKAELVKLLVQVLGSQDGA                                                  71 - 95
//

Text Mined References (3)

PMID Year Title