Property Summary

NCBI Gene PubMed Count 142
PubMed Score 785.16
PubTator Score 472.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
COPD -2.300 1.5e-03
non-small cell lung cancer -3.908 4.2e-08
lung cancer -2.200 1.7e-03
diabetes mellitus 1.100 1.7e-03
lung adenocarcinoma -4.671 1.8e-06
nasopharyngeal carcinoma -3.400 1.3e-04
lung carcinoma -4.600 1.4e-14
chronic rhinosinusitis -3.843 3.5e-03
cystic fibrosis and chronic rhinosinusit... -2.607 3.3e-03
psoriasis -1.600 4.0e-05

Synonym

Accession P11684 B2R5F2 Q6FHH3 Q9UCM2 Q9UCM4
Symbols UGB
UP1
CC10
CC16
CCSP
UP-1
CCPBP

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (131)

PMID Text
26914709 Lung-specific (CC-16) and novel (RelB) biomarkers are associated with systemic cardiovascular changes over time. CC-16 can predict subsequent exacerbations in subjects with severe COPD and may be an important biomarker of pulmonary and systemic stress in COPD.
26108072 lower levels of urine CC16 and lung function in patients with asthma than in those patients without asthma. CC16 in urine may be a useful tool or biomarker for investigating lung epithelium integrity among children with asthma or lung injury.
25851191 In chromium-exposed workers, blood levels of CC16, and CC16/SP-D were lower than in controls. Positive relationships were shown between CC16 or CC16/SP-D and indicators of lung function.
25743006 A meta-analysis indicated that the CC16 gene A38G polymorphism is not associated with the risk of asthma.
25728058 Sputum and bronchoalveolar lavage fluid CC16 were significantly higher in patients with severe asthma compared to mild-moderate asthma and healthy controls.
25700379 Smokers and COPD patients had reduced airway CC16 immunostaining that decreased with increasing COPD severity.
25635997 CC16 may play an important protective role in cigarette smoke-related diseases.
25631862 KL-6 levels were higher and CC16 levels were lower in infants with poor neurodevelopmental outcome compared with those infants who had favourable neurodevelopmental outcome.
25244495 The serum concentration of CC16 was significantly higher in patients with lung fibrosis.
25068828 the uteroglobin G38A gene polymorphism was not associated with IgAN risk
24782597 Uteroglobin is a possible ligand of the lipoxin receptor and it may have a role in inhibiting serum amyloid A-driven inflammation
24735334 Athletes with decreased serum CC16 from regular high-load exercise are more susceptible to respiratory infections.
24400993 Increased plasma clara cell secretory protein levels are associated with primary graft dysfunction.
24245748 Serum CC-16 is associated with disease progression in chronic obstructive pulmonary disease (COPD). However, the absence of CC-16 does not appear to modify the risk of cigarette-related COPD in mice.
24125144 These results suggest that the CC16 A38G polymorphism may play a role in asymptomatic airway hyper-responsiveness and contribute to the development of late-onset asthma.
24030662 A single therapeutic dose of terbutaline offers significant protection against hyperpnoea-induced bronchoconstriction and reduces urinary CC16 protein levels.
23874631 Lung permeability biomakers [surfactant protein D (SP-D) and Clara cell secretory protein (CC16) in plasma] and forced expiratory volumes and flow were measured in swimmers in indoor swimming pool waters treated with different disinfection methods.
23820082 The SCGB1A1 +38A/G polymorphism is a risk factor for asthma. [Meta-analysis]
23258467 Acute exposure to smoke induces injury at the alveolar level, which results in a transient increase of CC16 in serum of exposed subjects.
23144326 A Genome wide association study for COPD biomarkers on subjects with COPD found 2 discrete loci affecting CC16, one near the CC16 coding gene (SCGB1A1) on chromosome 11 and one approximately 25Mb away from SCGB1A1, identified in expressed sputum.
23030587 Overview of CC16 in pathophysiology of and as a biomarker in chronic obstructive pulmonary disease.
22902791 Donor CCSP A38G polymorphism is associated with decreased CCSP levels early after lung transplantation and poor long-term outcomes.
22883104 Clara cell secretory protein expression changes is a relevant marker in the development of bronchiolitis obliterans patients with lung transplantation.
22805990 urinary CC16 may be a useful biomarker of increased lung epithelial permeability among female non-smokers; further work will be required to evaluate its applicability to males
22788242 CC10 G+38A variant may contribute to the severity of asthma and lower level of steroid responsiveness.
22613976 demonstration that cc-10 is differentially expressed in infants with iRDS may point the way towards one possible mechanism that potentially involves modifications of the protein structure with its anti-inflammatory and surfactant protective function
22558282 These results indicate that CC10 gene transfer may inhibit airway inflammation through suppressing the activation of NF-kappaB.
21952535 Serum Clara cell secretory protein levels were characterized by an early postnatal surge. This apparent gestation-influenced surge may represent an initiation of a protective cascade against postnatal lung injury during extrauterine adaptation.
21799131 Exercise caused an increase in urinary excretion of CC16 in all subjects (P < 0.001), but this rise in CC16 was blunted following inhalation of warm humid air.
21767304 Single-nucleotide polymorphism in the CC10 gene (A38G) does not seem to be involved in the severity of respiratory syncytial virus infection or wheezing.
21299834 Elevated plasma clara cell secretory protein concentration is associated with high-grade primary graft dysfunction.
21255142 CC16 38A/38A genotype plays a role in the development of early asthma in children with AR.
21131866 Urinary levels of CC16 are increased after eucapnic voluntary hyperpnea.
21045740 Elevated circulating CC16 levels identified severe thoracic injury combined with a strong correlation with the extent/volume of affected lung tissue.
20736038 Observational study of gene-disease association. (HuGE Navigator)
20683434 Letter: serum CCSP cannot be used as a biomarker predictive for bronchiolitis obliterans after lung transplantation.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20664959 Data suggest that a supernatant of non-small-cell lung cancer causes an imbalance in the immune response of PBMCs and DCs, which is reversed by CC-10.
20603037 Observational study of gene-disease association. (HuGE Navigator)
20553297 In the context of allergic airway responses, CC10 can inhibit OPN expression and suppress the Th2-promoting function of OPN, resulting in CC10's inhibitory biological effects.
20536507 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20395963 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20037209 Observational study of gene-disease association. (HuGE Navigator)
19887851 Reduced anti-inflammatory CC10 concentrations in airways of extremely premature infants with a fetal inflammatory response, not umbilical cord serum CC10, might make their lungs susceptible for further postnatal injuries.
19852548 Association of CC16 with daily outdoor particulate matter from combustion sources increases epithelial barrier permeability in lungs.
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19729601 Observational study of gene-disease association. (HuGE Navigator)
19632988 Data show that comparing with similar fusion proteins in which uteroglobin was not used, the use of uteroglobin improved properties of solubility and stability.
19559392 Observational study of gene-disease association. (HuGE Navigator)
19527514 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19225544 Observational study of gene-disease association. (HuGE Navigator)
19222419 Observational study of gene-disease association. (HuGE Navigator)
19132521 propose that CC16 may down-modulate the entry of human eosinophils and neutrophils into the airways during inflammation in the lung
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19128353 SCGB1A1 A38G may play a role in the development and persistence of the asthma phenotype in childhood.
19128353 Observational study of gene-disease association. (HuGE Navigator)
19076932 CC10 may take part in the pathogenesis of CRS and correlates with disease severity. Different cytokines can regulate CC10 expression in nasal mucosa differentially through modulating mRNA stability and certain transcriptional factors expression.
19028820 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19019335 Observational study of gene-disease association. (HuGE Navigator)
18976364 serum CC16 levels elevated in children with respiratory syncytial virus infection
18974840 Observational study of gene-disease association. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18702901 The CC10 A + 38G SNP may not exert a substantial influence on the development of CRS in the Chinese Han population.
18521628 CC16 protein is a peripheral blood biomarker of lung injury in ventilated preterm neonates.
18316584 Higher levels of the anti-inflammatory protein CC10 are associated with improvement in bronchial dysplasia
18243143 Uteroglobin interacts with the heparin-binding site of fibronecti(Fn) and propose that small molecules competing for interaction with this site may reduce the level of circulating Fn-IgA complexes in immunoglobulin A (IgA)-nephropathy.
18201431 Observational study of gene-disease association. (HuGE Navigator)
17957145 Newborn piglets with meconium aspiration syndrome have physiologic dysfunction, inflammatory changes and histologic abnormalities, partially counteracted by a single dose of exogenous surfactant and CC10.
17928103 Study provides evidence for the first time for AF-1 binding with uteroglobin(UG)-binding protein, and preliminarily characterized UG-binding protein as a point downstream of AF-1 in mediating ERK phosphorylation.
17716718 Observational study of gene-disease association. (HuGE Navigator)
17716718 study found that infant frequent wheezing is associated with the CC10 G+38A polymorphism and lower CC10 levels but not infant atopy
17703412 Observational study of gene-disease association. (HuGE Navigator)
17693780 Serum Clara cell protein 16(CC16) concentrations decreased in silica-exposed miners and may be a useful biomarker for early diagnosis of silicosis.
17531233 Uteroglobin is present in the human fallopian tube as a secretory protein and appears to be involved in immunosuppressive responses in the fallopian tube.
17507989 The metabolic pathway of CC10 was studied.
17338426 Observational study of gene-disease association. (HuGE Navigator)
17207022 Observational study of gene-disease association. (HuGE Navigator)
17207022 The genetic polymorphism in CC16 38 A/G is not associated with susceptibility to COPD in a southern Chinese population of Han nationality.
17094107 Uteroglobin induces the development and cellular proliferation of the mouse early embryo.
16797381 Meta-analysis of gene-disease association. (HuGE Navigator)
16764982 Observational study of gene-disease association. (HuGE Navigator)
16703373 Observational study of gene-disease association. (HuGE Navigator)
16703373 These results do not support a role for UG in susceptibility to childhood Henoch-Schonlein purpura.
16690962 CC10 is detectable in the blood of newborn infants, and a production surge occurs at birth; surge is more pronounced in term infants and may confer them with superior extrauterine pulmonary protection compared with preterm infants
16387800 Observational study of gene-disease association. (HuGE Navigator)
16387800 Subjects with CC16 38AA were more likely to have moderate or severe acute asthma.
16215398 Observational study of gene-disease association. (HuGE Navigator)
16081627 Given that inflammation may lead to functional compromise, these data suggest that early intervention with rhCC10 may enhance SF therapy.
16061484 uteroglobin plays important roles in maintaining homeostasis in organs that are vulnerable to inadvertent stimulation of FP-mediated inflammatory response by inhibiting the prostaglandin F2alpha receptor
15829319 induction of uteroglobin expression has inhibitory effect on COX-2 expression in lung cancer cells via suppression of nuclear factor kappa-B activity
15813809 Reduction in anti-inflammatory activity by CC16 may contribute to the pathogenesis of allergic rhinitis.
15744536 Observational study of gene-disease association. (HuGE Navigator)
15744536 Polymorphism A38G and its role in asthma is studied.
15677460 Uteroglobin suppresses SCCA gene expression associated with airway inflammation in asthma
15549500 Observational study of gene-disease association. (HuGE Navigator)
15480316 CC10 was the most down-regulated gene in human nasal polyp tissues studied by means of DNA microarray
15467329 These data provide new insights into the role of CC-10 in lung diseases and the possibility that the CC-10 concentration in serum could be a new marker indicating the severity of bronchial asthma.
15297273 Observational study of gene-disease association. (HuGE Navigator)
15148962 Combination of CC16, GSTM1, and GSTT1 genetic polymorphisms is associated with asthma.
15148333 Uteroglobin is an essential component of a novel innate homeostatic mechanism in the mammalian airways to repress allergen-induced inflammatory responses.
14990020 Observational study of gene-disease association. (HuGE Navigator)
14990020 Uteroglobin G38A polymorphism had no association with the development of IgA nephropathy.
14735466 uteroglobin expression is regulated by progesterone in the normal endometrium but regulation by progesterone receptor is lost in endometrial hyperplasia and carcinoma according to acquirement of tumorigenesis
14719079 The presence of UG significantly correlated with the expression of estrogen receptor alpha and Progesterone rseceptor in endometrial cancer.
14669228 Observational study of gene-disease association. (HuGE Navigator)
14551164 Observational study of gene-disease association. (HuGE Navigator)
14551164 G38A polymorphism in the CC10 gene may influence protein expression and be associated with the development of progressive sarcoidosis
12927696 results suggest that rP1 inhibits platelet aggregation by participation in the actin polymerization through which store mediated calcium entry is mediated
12642831 CC16*A38G single-nucleotide polymorphism influences bronchial hyperreactivity and might be a genetic determinant of asthma severity in German children.
12204889 COUP-transcription factors may play a pivotal role in cell specificity of the human CC10 gene by inhibiting its expression in nonpermissive cells
12200800 In IgA nephropathy, circulating UGB is not reduced and is even increased in IgA-Fn complexes, suggesting a feedback mechanism to downregulate the formation and circulation of IgA1-Fn complexes.
12127976 Lys 43 and Asp 46 in rhUG are critical residues for the sPLA2-inhibitory activity of UG
12100044 Observational study of gene-disease association. (HuGE Navigator)
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12014016 is a regulator of the inflammatory process in respiratory diseases
12003994 Observational study of gene-disease association. (HuGE Navigator)
11967037 Observational study of gene-disease association. (HuGE Navigator)
11967037 Role of uteroglobin G38A polymorphism in the progression of IgA nephropathy in Japanese patients.
11774099 Observational study of gene-disease association. (HuGE Navigator)
11774099 The effect of G38A may be apparent under stimulation as sex steroids or infections, and homozygotes of the G38A mutation cannot produce sufficient UG in response to stimulation and may be predisposed to IgA nephropathy, especially in childhood.
11434507 Observational study of gene-disease association. (HuGE Navigator)
11258696 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP      1 - 70
QKPRESIIKLMEKIAQSSLCN                                                      71 - 91
//

Text Mined References (144)

PMID Year Title
26914709 2016 Club Cell-16 and RelB as Novel Determinants of Arterial Stiffness in Exacerbating COPD Patients.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26108072 Association of urine CC16 and lung function and asthma in Chinese children.
25851191 2015 Biomarkers for lung epithelium injury in occupational hexavalent chromium-exposed workers.
25743006 2015 CC16 gene A38G polymorphism and susceptibility to asthma: an updated meta-analysis.
25728058 2015 Sputum and BAL Clara cell secretory protein and surfactant protein D levels in asthma.
25700379 2015 Protective role for club cell secretory protein-16 (CC16) in the development of COPD.
25635997 2015 Repression of CC16 by cigarette smoke (CS) exposure.
25631862 2015 Correlation of serum KL-6 and CC16 levels with neurodevelopmental outcome in premature infants at 12 months corrected age.
25416956 2014 A proteome-scale map of the human interactome network.
25244495 2015 Diagnostic Values For Club Cell Secretory Protein (CC16) in Serum of Patients of Combined Pulmonary Fibrosis and Emphysema.
25068828 2015 Association of uteroglobin G38A gene polymorphism with IgA nephropathy risk: an updated meta-analysis.
24782597 2014 Uteroglobin, a possible ligand of the lipoxin receptor inhibits serum amyloid A-driven inflammation.
24735334 2014 Association of serum Clara cell protein CC16 with respiratory infections and immune response to respiratory pathogens in elite athletes.
24400993 2014 Preoperative plasma club (clara) cell secretory protein levels are associated with primary graft dysfunction after lung transplantation.
24245748 2013 Club cell protein 16 and disease progression in chronic obstructive pulmonary disease.
24125144 2013 The CC16 A38G polymorphism is associated with asymptomatic airway hyper-responsiveness and development of late-onset asthma.
24030662 2013 Effect of terbutaline on hyperpnoea-induced bronchoconstriction and urinary club cell protein 16 in athletes.
23874631 2013 Respiratory function and changes in lung epithelium biomarkers after a short-training intervention in chlorinated vs. ozone indoor pools.
23820082 2013 Secretoglobin 1A member 1 (SCGB1A1) +38A/G polymorphism is associated with asthma risk: a meta-analysis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23258467 2013 Clara Cell protein and myeloperoxidase levels in serum of subjects after exposure to fire smoke.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
23030587 2012 CC-16 as a biomarker in chronic obstructive pulmonary disease.
22902791 2012 Donor clara cell secretory protein polymorphism is a risk factor for bronchiolitis obliterans syndrome after lung transplantation.
22883104 2012 Epithelial clara cell injury occurs in bronchiolitis obliterans syndrome after human lung transplantation.
22805990 2013 Utility of urinary Clara cell protein (CC16) to demonstrate increased lung epithelial permeability in non-smokers exposed to outdoor secondhand smoke.
22788242 2012 Evaluation of a common variant of the gene encoding clara cell 10 kd protein (CC10) as a candidate determinant for asthma severity and steroid responsiveness among Chinese children.
22613976 2012 Clara cell protein expression in human neonates during respiratory distress syndrome.
22558282 2012 Clara cell 10-kDa protein gene transfection inhibits NF-?B activity in airway epithelial cells.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
21952535 2012 Early postnatal surge of serum Clara cell secretory protein in newborn infants.
21799131 2011 Effect of inspired air conditions on exercise-induced bronchoconstriction and urinary CC16 levels in athletes.
21767304 2012 Clara cell protein 10 polymorphism is not associated with severe respiratory syncytial virus infection.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21299834 2011 Elevated plasma clara cell secretory protein concentration is associated with high-grade primary graft dysfunction.
21255142 2011 The CC16 A38G polymorphism is associated with the development of asthma in children with allergic rhinitis.
21131866 2011 Hyperpnea-induced bronchoconstriction and urinary CC16 levels in athletes.
21045740 2011 Circulating levels of Clara cell protein 16 but not surfactant protein D identify and quantify lung damage in patients with multiple injuries.
20736038 2010 Association of STR polymorphisms in CMA1 and IL-4 with asthma and atopy: the SAPALDIA cohort.
20683434 2010 Clara cell secretory protein and surfactant protein-D do not predict bronchiolitis obliterans syndrome after lung transplantation.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20664959 2010 The immune modulation of Clara cell-10 in human peripheral monocytes and dendritic cells.
20603037 2010 Single nucleotide polymorphisms in inflammation-related genes are associated with venous thromboembolism.
20553297 2010 The expression of osteopontin and its association with Clara cell 10 kDa protein in allergic rhinitis.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20395963 2010 Replication of genetic association studies in asthma and related phenotypes.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20037209 2009 Genetic factors associated with rheumatoid arthritis and systemic vasculitis: Evaluation of a panel of polymorphisms.
19887851 2010 Clara cell secretory protein in tracheobronchial aspirates and umbilical cord serum of extremely premature infants with systemic inflammation.
19852548 2009 Source category-specific PM2.5 and urinary levels of Clara cell protein CC16. The ULTRA study.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19729601 2009 Candidate gene polymorphisms for ischemic stroke.
19632988 2009 Use of uteroglobin for the engineering of polyvalent, polyspecific fusion proteins.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19225544 2009 Variation in the lymphotoxin-alpha/tumor necrosis factor locus modifies risk of erythema nodosum in sarcoidosis.
19222419 2009 Opposite gene by environment interactions in Karelia for CD14 and CC16 single nucleotide polymorphisms and allergy.
19132521 2009 CC16 inhibits the migration of eosinophils towards the formyl peptide fMLF but not towards PGD2.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19128353 2009 Cross-sectional and longitudinal association of the secretoglobin 1A1 gene A38G polymorphism with asthma phenotype in the Perth Infant Asthma Follow-up cohort.
19076932 2009 Clara cell 10-kDa protein expression in chronic rhinosinusitis and its cytokine-driven regulation in sinonasal mucosa.
19028820 2009 Polymorphisms in inflammatory genes and the risk of ischemic stroke and transient ischemic attack: results of a multilocus genotyping assay.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
18976364 2009 Clara cell protein 16 (CC16) serum levels in infants during respiratory syncytial virus infection.
18974840 2008 Identification of novel single nucleotide polymorphisms in inflammatory genes as risk factors associated with trachomatous trichiasis.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18702901 Lack of association of Clara cell 10-kDa protein gene variant with chronic rhinosinusitis in a Chinese Han population.
18521628 2008 Clara cell secretory protein (CC16) as a peripheral blood biomarker of lung injury in ventilated preterm neonates.
18316584 2008 Higher levels of the anti-inflammatory protein CC10 are associated with improvement in bronchial dysplasia and sputum cytometric assessment in individuals at high risk for lung cancer.
18243143 2008 Uteroglobin interacts with the heparin-binding site of fibronectin and prevents fibronectin-IgA complex formation found in IgA-nephropathy.
18201431 Uteroglobin-related protein 1 gene -112G/a polymorphism and atopic asthma in Sicilian children.
17957145 2007 CC10 reduces inflammation in meconium aspiration syndrome in newborn piglets.
17928103 2007 Interaction of antiflammin-1 with uteroglobin-binding protein induces phosphorylation of ERK1/2 in NIH 3T3 cells.
17716718 2007 Infant frequent wheezing correlated to Clara cell protein 10 (CC10) polymorphism and concentration, but not allergy sensitization, in a perinatal cohort study.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17693780 2007 Roles of serum clara cell protein 16 and surfactant protein-D in the early diagnosis and progression of silicosis.
17531233 2008 Increased expression of uteroglobin associated with tubal inflammation and ectopic pregnancy.
17507989 2007 Achaete-scute homolog-1 linked to remodeling and preneoplasia of pulmonary epithelium.
17338426 2007 Association between the clara cell secretory protein (CC16) G38A polymorphism and the progression of IgA nephropathy.
17207022 2007 Genetic analysis of CC16, OGG1 and GCLC polymorphisms and susceptibility to COPD.
17094107 2007 Uteroglobin induces the development and cellular proliferation of the mouse early embryo.
16797381 2006 Association of uteroglobin G38A polymorphism with IgA nephropathy: a meta-analysis.
16764982 2006 No association between the Clara cell secretory protein (CC16) gene polymorphism and personality traits.
16703373 2006 Analysis of a uteroglobin gene polymorphism in childhood Henoch-Schonlein purpura.
16690962 2006 The influence of gestation and mechanical ventilation on serum clara cell secretory protein (CC10) concentrations in ventilated and nonventilated newborn infants.
16423471 2006 Interaction of uteroglobin with lipocalin-1 receptor suppresses cancer cell motility and invasion.
16387800 2006 Acute asthma in children: Relationships among CD14 and CC16 genotypes, plasma levels, and severity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16215398 2005 Evaluation of the -26G>A CC16 polymorphism in acute respiratory distress syndrome.
16081627 2005 Dose response to rhCC10-augmented surfactant therapy in a lamb model of infant respiratory distress syndrome: physiological, inflammatory, and kinetic profiles.
16061484 2005 Uteroglobin inhibits prostaglandin F2alpha receptor-mediated expression of genes critical for the production of pro-inflammatory lipid mediators.
15829319 2005 Adenovirus-uteroglobin suppresses COX-2 expression via inhibition of NF-kappaB activity in lung cancer cells.
15813809 2005 Low levels of CC16 in nasal fluid of children with birch pollen-induced rhinitis.
15744536 2005 Association between asthma-related phenotypes and the CC16 A38G polymorphism in an unselected population of young adult Danes.
15677460 2005 Uteroglobin suppresses SCCA gene expression associated with allergic asthma.
15549500 2004 Association of an intragenic microsatellite marker in the CC16 gene with asthma in the Indian population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15480316 2004 Gene expression profiles in human nasal polyp tissues studied by means of DNA microarray.
15467329 Serum CC-10 in inflammatory lung diseases.
15297273 2004 The Clara cell10 adenine38guanine polymorphism and sarcoidosis susceptibility in Dutch and Japanese subjects.
15148962 2004 Combination of CC16, GSTM1, and GSTT1 genetic polymorphisms is associated with asthma.
15148333 2004 Uteroglobin represses allergen-induced inflammatory response by blocking PGD2 receptor-mediated functions.
14990020 2004 [Uteroglobin G38A polymorphism is associated with the progression of IgA nephropathy in Chinese patients].
14735466 2004 Expression of uteroglobin in normal and carcinogenic endometrium and influence of hormone replacement therapy.
14719079 2004 Expression of uteroglobin and matrix metalloproteinase-9 genes in endometrial cancer: relationship to estrogen and progesterone receptor status.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14669228 2003 [Study on association between CC16 gene G38A mutation and asthma in the patients of Han population in Chongqing, China].
14551164 2004 Polymorphism of Clara cell 10-kD protein gene of sarcoidosis.
12927696 2003 Recombinant protein 1/secretoglobin 1A1 participates in the actin polymerization of human platelets.
12642831 2003 Clara cell protein 16 (CC16) gene polymorphism influences the degree of airway responsiveness in asthmatic children.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12204889 2002 Regulation of human Clara cell 10 kD protein expression by chicken ovalbumin upstream promoter transcription factors (COUP-TFs).
12200800 2002 In human IgA nephropathy uteroglobin does not play the role inferred from transgenic mice.
12127976 2002 Lys 43 and Asp 46 in alpha-helix 3 of uteroglobin are essential for its phospholipase A2 inhibitory activity.
12100044 2002 An association study between the Clara cell secretory protein CC16 A38G polymorphism and asthma phenotypes.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12003994 2002 Polymorphism of the uteroglobin gene in systemic lupus erythematosus and IgA nephropathy.
11967037 2002 Role of uteroglobin G38A polymorphism in the progression of IgA nephropathy in Japanese patients.
11788998 2002 Newly identified proteins in human nasal lavage fluid from non-smokers and smokers using two-dimensional gel electrophoresis and peptide mass fingerprinting.
11434507 2001 Uteroglobin gene polymorphisms affect the progression of immunoglobulin A nephropathy by modulating the level of uteroglobin expression.
11278724 2001 A two-receptor pathway for catabolism of Clara cell secretory protein in the kidney.
11258696 2001 Genetic polymorphisms as biomarkers of sensitivity to inhaled sulfur dioxide in subjects with asthma.
11193760 2000 Uteroglobin binding proteins: regulation of cellular motility and invasion in normal and cancer cells.
10587371 1999 Expression of uteroglobin in the human endometrium.
10470078 1999 Uteroglobin is essential in preventing immunoglobulin A nephropathy in mice.
9643286 1998 A polymorphism of the CC16 gene is associated with an increased risk of asthma.
9022046 1997 Human uteroglobin gene: structure, subchromosomal localization, and polymorphism.
7733299 1995 Human CC10 gene expression in airway epithelium and subchromosomal locus suggest linkage to airway disease.
7664082 1994 Structure of a human Clara cell phospholipid-binding protein-ligand complex at 1.9 A resolution.
7521325 1994 Clara cell 10 kDa protein mRNA in normal and atypical regions of human respiratory epithelium.
3275712 1988 Identification, cellular localization, isolation, and characterization of human Clara cell-specific 10 KD protein.
3167058 1988 Amino-acid and cDNA nucleotide sequences of human Clara cell 10 kDa protein.
1400743 1992 Simple and high-yield purification of urine protein 1 using immunoaffinity chromatography: evidence for the identity of urine protein 1 and human Clara cell 10-kilodalton protein.
1395029 1992 Human urinary protein 1: evidence for identity with the Clara cell protein and occurrence in respiratory tract and urogenital secretions.
1284526 1992 Human CC10, the homologue of rabbit uteroglobin: genomic cloning, chromosomal localization and expression in endometrial cell lines.