Property Summary

NCBI Gene PubMed Count 147
PubMed Score 814.23
PubTator Score 472.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
chronic rhinosinusitis -3.843 3.5e-03
COPD -2.300 1.5e-03
cystic fibrosis and chronic rhinosinusit... -2.607 3.3e-03
diabetes mellitus 1.100 1.7e-03
lung adenocarcinoma -2.500 4.9e-05
lung cancer -2.200 1.7e-03
lung carcinoma -4.600 1.4e-14
nasopharyngeal carcinoma -3.400 1.3e-04
non-small cell lung cancer -3.908 4.2e-08
psoriasis -1.600 4.0e-05

Gene RIF (135)

AA Sequence

MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP      1 - 70
QKPRESIIKLMEKIAQSSLCN                                                      71 - 91
//

Text Mined References (149)

PMID Year Title