Property Summary

NCBI Gene PubMed Count 15
PubMed Score 276.26
PubTator Score 86.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.546 1.6e-02
Multiple myeloma -1.792 7.8e-04
astrocytic glioma 1.400 4.5e-02
oligodendroglioma 2.600 2.0e-03
osteosarcoma 1.702 1.7e-03
group 4 medulloblastoma -1.700 4.8e-05
cystic fibrosis 2.038 5.1e-07
atypical teratoid / rhabdoid tumor -2.700 1.0e-04
glioblastoma 1.600 2.1e-03
medulloblastoma, large-cell -2.200 4.2e-06
tuberculosis 1.300 2.1e-03
intraductal papillary-mucinous adenoma (... -3.000 1.2e-03
intraductal papillary-mucinous carcinoma... -3.800 1.9e-04
intraductal papillary-mucinous neoplasm ... -2.300 3.6e-02
pancreatic cancer -1.100 2.2e-03
lung adenocarcinoma -1.800 1.1e-06
adult high grade glioma 1.400 8.2e-03
pilocytic astrocytoma 1.500 1.0e-03
posterior fossa group A ependymoma -1.100 4.8e-05
aldosterone-producing adenoma -1.047 4.6e-02
psoriasis -1.700 5.8e-14
subependymal giant cell astrocytoma -2.588 1.1e-03
nasopharyngeal carcinoma 1.300 7.9e-03
Alzheimer's disease -1.200 2.6e-02
Pick disease -1.600 1.3e-04
progressive supranuclear palsy -1.100 2.0e-02
Breast cancer -2.400 2.1e-07
ovarian cancer -2.800 9.1e-06

Gene RIF (10)

PMID Text
25802234 SCD5 appears to functionally connect tumour cells and the surrounding stroma toward modification of the tumour microenvironment, with consequences on tumour spread and resistance to treatment.
23867797 The protective effect of TO901317 was lost after gene silencing of Scd-1/-2, thereby confirming that the protective effect of TO901317 is mediated by Scd-1/-2.
22745828 Data suggest that, by a coordinated modulation of key lipogenic pathways and transduction signaling cascades, SCD5 participates in the regulation of neuronal cell growth and differentiation.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17468887 In this paper, we describe for the first time a second SCD isoform in cattle, which appears to be an ortholog of human SCD5 rather than a homolog of bovine SCD1 or any of the described murine SCD isoforms
15610069 The identification and characterization of SCD2, and its relationship to human SCD1 and mouse SCD2, are reported.
12815040 SCD4 demonstrates tissue-specific regulation by leptin and dietary factors

AA Sequence

MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGAVYSLVLIPKA      1 - 70
KPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAFQNDIFEWSRDHRAHHKYSET     71 - 140
DADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLLADPVVRIQRKYYKISVVLMCFVVPTLVPWY    141 - 210
IWGESLWNSYFLASILRYTISLNISWLVNSAAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPF    211 - 280
DYSASEFGLNFNPTTWFIDFMCWLGLATDRKRATKPMIEARKARTGDSSA                        281 - 330
//

Text Mined References (20)

PMID Year Title
25802234 2015 SCD5-induced oleic acid production reduces melanoma malignancy by intracellular retention of SPARC and cathepsin B.
23867797 2013 Susceptibility of podocytes to palmitic acid is regulated by stearoyl-CoA desaturases 1 and 2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22745828 2012 StearoylCoA desaturase-5: a novel regulator of neuronal cell proliferation and differentiation.
22046234 2011 Elevated stearoyl-CoA desaturase in brains of patients with Alzheimer's disease.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17468887 2007 Identification and characterization of a novel bovine stearoyl-CoA desaturase isoform with homology to human SCD5.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15907797 2005 Characterization of HSCD5, a novel human stearoyl-CoA desaturase unique to primates.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15610069 2005 Characterization of human SCD2, an oligomeric desaturase with improved stability and enzyme activity by cross-linking in intact cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12727354 2003 Identification and characterization of a novel gene disrupted by a pericentric inversion inv(4)(p13.1q21.1) in a family with cleft lip.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.