Property Summary

NCBI Gene PubMed Count 17
PubMed Score 18.57
PubTator Score 11.26

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (6)

Disease log2 FC p
gastric carcinoma 1.200 2.6e-02
intraductal papillary-mucinous neoplasm ... -1.400 2.7e-04
Multiple myeloma 1.046 1.7e-02
osteosarcoma 1.442 4.0e-05
ovarian cancer 2.200 3.6e-06
psoriasis 2.400 1.3e-05

Gene RIF (2)

AA Sequence

IRTKEQIVEMLVQEQLLAILPEAARARRIRRRTDVRITG                                   141 - 179

Text Mined References (17)

PMID Year Title