Property Summary

NCBI Gene PubMed Count 18
PubMed Score 8.89
PubTator Score 4.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Crohn Disease 97
Disease Target Count P-value
ovarian cancer 8491 1.6e-05
lung cancer 4473 6.4e-03
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 2.0
Gastrointestinal system disease 50 0.0 1.0
Disease Target Count Z-score Confidence
Hepatocellular Adenoma 10 3.092 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.100 6.4e-03
ovarian cancer 1.600 1.6e-05

Gene RIF (6)

PMID Text
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of secretory carrier membrane protein 3 (SCAMP3) expression by HIV-1 Vpr in Vpr transduced macrophages
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of secretory carrier membrane protein 3 (SCAMP3) expression by HIV-1 Vpr in Vpr transduced macrophages
21951651 SCAMP3 has a positive role in sorting into and budding of intralumenal vesicles and thereby controls the process of multivesicular endosome biogenesis.
19438519 SCAMP3 tubules reflect a manipulation of specific post-Golgi trafficking that might allow Salmonella to acquire nutrients and membrane, or to control host immune responses.
19158374 Depletion of SCAMP3 in HeLa cells by inhibitory RNA accelerated degradation of epidermal growth factor receptor (EGFR) and EGF while inhibiting recycling
9378760 the SCAMPs may largely function at the same sites during vesicular transport rather than in separate post-Golgi recycling pathways.

AA Sequence

MAQSRDGGNPFAEPSELDNPFQDPAVIQHRPSRQYATLDVYNPFETREPPPAYEPPAPAPLPPPSAPSLQ      1 - 70
PSRKLSPTEPKNYGSYSTQASAAAATAELLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPS     71 - 140
FCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVETNNGAGFGLSILWVLLFT    141 - 210
PCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLML    211 - 280
LVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSNPAVRTAAANAAAGAAENAFRAP       281 - 347
//

Text Mined References (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21951651 2012 Regulation of the MVB pathway by SCAMP3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19438519 2009 SCAMP3 is a component of the Salmonella-induced tubular network and reveals an interaction between bacterial effectors and post-Golgi trafficking.
19158374 2009 SCAMP3 negatively regulates epidermal growth factor receptor degradation and promotes receptor recycling.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16341674 2005 Transcriptome analysis of human gastric cancer.
16105885 2005 Ubiquitously expressed secretory carrier membrane proteins (SCAMPs) 1-4 mark different pathways and exhibit limited constitutive trafficking to and from the cell surface.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10777571 2000 SCAMP1 function in endocytosis.
9658162 1998 Tyrosine phosphorylation of selected secretory carrier membrane proteins, SCAMP1 and SCAMP3, and association with the EGF receptor.
9378760 1997 Three mammalian SCAMPs (secretory carrier membrane proteins) are highly related products of distinct genes having similar subcellular distributions.
9331372 1997 Identification of three additional genes contiguous to the glucocerebrosidase locus on chromosome 1q21: implications for Gaucher disease.
9224770 1997 Evidence for colocalization and interaction between 37 and 39 kDa isoforms of secretory carrier membrane proteins (SCAMPs).