Property Summary

NCBI Gene PubMed Count 17
PubMed Score 10.96
PubTator Score 10.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.3e-03
astrocytoma 1493 3.7e-03
lung cancer 4473 5.4e-03
glioblastoma 5572 3.1e-02
Disease Target Count Z-score Confidence
Bartter Disease 12 3.557 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.700 3.7e-03
glioblastoma 1.200 3.1e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.3e-03
lung cancer -1.300 5.4e-03

Gene RIF (5)

PMID Text
21295544 this finding that SCAMP2 interacts with and regulates the subcellular distribution of both DAT and SERT suggests that interaction with SCAMP2 may constitute an important mechanism for coordinating cell surface expression of monoamine transporters.
20424473 Observational study of gene-disease association. (HuGE Navigator)
19276089 SCAMP2 regulates NHE5 transit through recycling endosomes and promotes its surface targeting in an Arf6-dependent manner.
17713930 The strong correlation between SCAMP2 E interactions with PIP2 and inhibition of exocytosis, particularly by SC2-R204A, led us to propose that SCAMP2 interaction with PIP2 within the membrane interface regulates fusion pore formation during exocytosis.
16870614 SCAMP2 plays an important role in the regulation of the subcellular distribution of SERT

AA Sequence

MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT      1 - 70
QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE     71 - 140
IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF    141 - 210
RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV    211 - 280
FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN                         281 - 329
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21490707 2011 Genome-wide meta-analysis identifies regions on 7p21 (AHR) and 15q24 (CYP1A2) as determinants of habitual caffeine consumption.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21295544 2011 Modulation of the dopamine transporter by interaction with Secretory Carrier Membrane Protein 2.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19276089 2009 Secretory Carrier Membrane Protein 2 Regulates Cell-surface Targeting of Brain-enriched Na+/H+ Exchanger NHE5.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17713930 2007 Secretory carrier membrane protein SCAMP2 and phosphatidylinositol 4,5-bisphosphate interactions in the regulation of dense core vesicle exocytosis.
16870614 2006 Subcellular redistribution of the serotonin transporter by secretory carrier membrane protein 2.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15840657 2005 Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475951 2002 Role of secretory carrier membrane protein SCAMP2 in granule exocytosis.
12124380 2002 Perturbation of a very late step of regulated exocytosis by a secretory carrier membrane protein (SCAMP2)-derived peptide.
9378760 1997 Three mammalian SCAMPs (secretory carrier membrane proteins) are highly related products of distinct genes having similar subcellular distributions.
9224770 1997 Evidence for colocalization and interaction between 37 and 39 kDa isoforms of secretory carrier membrane proteins (SCAMPs).