Property Summary

NCBI Gene PubMed Count 25
PubMed Score 0.00
PubTator Score 34.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
gastric cancer -1.100 3.3e-03
pancreatic cancer -1.300 3.5e-03
Multiple myeloma 1.234 1.2e-02
malignant mesothelioma -1.600 1.0e-04
astrocytic glioma -1.800 4.6e-03
ependymoma -1.800 4.0e-03
oligodendroglioma -1.500 1.7e-02
psoriasis -1.500 7.1e-05
glioblastoma -2.400 2.0e-07
osteosarcoma 3.653 1.9e-08
group 4 medulloblastoma 1.700 2.4e-02
atypical teratoid / rhabdoid tumor -2.100 1.3e-08
medulloblastoma, large-cell 1.800 2.6e-04
primitive neuroectodermal tumor -1.100 6.3e-04
adrenocortical carcinoma 1.222 7.1e-03
intraductal papillary-mucinous adenoma (... 1.700 6.8e-03
intraductal papillary-mucinous carcinoma... 1.600 7.0e-03
lung cancer 1.100 3.8e-02
Parkinson's disease -1.400 4.5e-02
Breast cancer 3.400 2.7e-02
interstitial cystitis -1.100 1.8e-04
pediatric high grade glioma -2.000 6.5e-08
pilocytic astrocytoma -1.600 2.1e-07
non primary Sjogren syndrome sicca -1.100 2.5e-02
pancreatic carcinoma -1.300 3.5e-03
lung carcinoma 1.500 3.5e-28
Pick disease -1.200 1.9e-03
ovarian cancer 2.000 1.3e-03
Gaucher disease type 1 -1.500 2.3e-02
dermatomyositis 1.900 8.4e-04

Gene RIF (2)

PMID Text
23653380 RNA interference-mediated downregulation of SCAMP1 resulted in a marked reduction in cell migration and invasion, but not proliferation in tumor cell lines.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSDFDSNPFADPDLNNPFKDPSVTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPNVPNTQPAIMKPTEEH      1 - 70
PAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKNNWPPLPSNFPVGPCFYQDFSVD     71 - 140
IPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVCWYRPLYGAF    141 - 210
RSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLV    211 - 280
MFKKVHGLYRTTGASFEKAQQEFATGVMSNKTVQTAAANAASTAASSAAQNAFKGNQI                281 - 338
//

Text Mined References (30)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23653380 2013 Inhibition of SCAMP1 suppresses cell migration and invasion in human pancreatic and gallbladder cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19668339 2009 Hippocampal atrophy as a quantitative trait in a genome-wide association study identifying novel susceptibility genes for Alzheimer's disease.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15840657 2005 Secretory carrier membrane proteins interact and regulate trafficking of the organellar (Na+,K+)/H+ exchanger NHE7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475951 2002 Role of secretory carrier membrane protein SCAMP2 in granule exocytosis.
12124380 2002 Perturbation of a very late step of regulated exocytosis by a secretory carrier membrane protein (SCAMP2)-derived peptide.
11050114 2000 Novel SCAMPs lacking NPF repeats: ubiquitous and synaptic vesicle-specific forms implicate SCAMPs in multiple membrane-trafficking functions.
11042173 2001 Proteomics characterization of abundant Golgi membrane proteins.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10777571 2000 SCAMP1 function in endocytosis.
9658162 1998 Tyrosine phosphorylation of selected secretory carrier membrane proteins, SCAMP1 and SCAMP3, and association with the EGF receptor.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
9378760 1997 Three mammalian SCAMPs (secretory carrier membrane proteins) are highly related products of distinct genes having similar subcellular distributions.
9224770 1997 Evidence for colocalization and interaction between 37 and 39 kDa isoforms of secretory carrier membrane proteins (SCAMPs).
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8404846 1993 SCAMP 37, a new marker within the general cell surface recycling system.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.