Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.91
PubTator Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hepatomegaly 285 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Cor pulmonale 6 3.343 1.7

Expression

  Differential Expression (15)

Disease log2 FC p
active ulcerative colitis 1.450 2.1e-02
adult high grade glioma 1.100 4.3e-03
Breast cancer -1.700 7.4e-04
cystic fibrosis -4.762 7.3e-08
ependymoma 1.400 1.7e-04
fibroadenoma 1.900 4.5e-03
gastric carcinoma -2.000 5.0e-02
glioblastoma 1.400 1.0e-02
group 3 medulloblastoma 2.100 3.2e-03
lung adenocarcinoma -1.800 6.4e-17
lung carcinoma -1.600 2.9e-16
malignant mesothelioma -2.800 3.2e-07
medulloblastoma, large-cell 1.200 2.1e-04
non-small cell lung cancer -1.431 8.7e-17
ovarian cancer -3.700 1.1e-14

Protein-protein Interaction (3)

AA Sequence

MRTLWMALCALSRLWPGAQAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACRFTGDCCFDYDRAC      1 - 70
PARPCFVGEWSPWSGCADQCKPTTRVRRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHTYVPAF     71 - 140
ITTSAFNKERTRQATSPHWSTHTEDAGYCMEFKTESLTPHCALENWPLTRWMQYLREGYTVCVDCQPPAM    141 - 210
NSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI                    211 - 264
//

Text Mined References (10)

PMID Year Title