Property Summary

NCBI Gene PubMed Count 13
PubMed Score 19.52
PubTator Score 8.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer 1.295 4.7e-06
cystic fibrosis 1.400 2.8e-02

Synonym

Accession Q6UWP8 A8K5J0 E9PBV3
Symbols UNQ698

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

PMID Text
25283635 Findings suggest that SBSN is involved in the angiogenic potential of tumor endothelial cells (TEC) and may be a novel TEC marker.
23144906 These results support suprabasin as novel oncogene candidate in salivary gland adenoid cystic carcinoma.
22792300 BORIS induces demethylation of the SBSN CpG island and disruption and activation of chromatin around the SBSN transcription start site, resulting in an increase in SBSN expression.

AA Sequence

MHLARLVGSCSLLLLLGALSGWAASDDPIEKVIEGINRGLSNAEREVGKALDGINSGITHAGREVEKVFN      1 - 70
GLSNMGSHTGKELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQVGKEADKLIHHGVHH     71 - 140
GANQAGSEAGKFGQGVDNAAGQAGNEAGRFGQGVHHAAGQAGNEAGRFGQGVHHAAGQAGNEAGRFGQGA    141 - 210
HHGLSEGWKETEKFGQGIHHAAGQVGKEAEKFGQGAHHAAGQAGNEAGRFGQGVHHGLSEGWKETEKFGQ    211 - 280
GVHHTAGQVGKEAEKFGQGAHHAAGQAGNEAGRFGQGAHHAAGQAGNEAGRFGQGVHHGLSEGWKETEKF    281 - 350
GQGVHHAASQFGKETEKLGHGVHHGVNEAWKEAEKFGQGVHHAASQVGKEEDRVVQGLHHGVSQAGREAG    351 - 420
QFGHDIHHTAGQAGKEGDIAVHGVQPGVHEAGKEAGQFGQGVHHTLEQAGKEADKAVQGFHTGVHQAGKE    421 - 490
AEKLGQGVNHAADQAGKEVEKLGQGAHHAAGQAGKELQNAHNGVNQASKEANQLLNGNHQSGSSSHQGGA    491 - 560
TTTPLASGASVNTPFINLPALWRSVANIMP                                            561 - 590
//

Text Mined References (18)

PMID Year Title
25283635 2014 Suprabasin as a novel tumor endothelial cell marker.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23144906 2012 Suprabasin is hypomethylated and associated with metastasis in salivary adenoid cystic carcinoma.
22792300 2012 Dose-dependent activation of putative oncogene SBSN by BORIS.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15256262 2004 Identification of a conserved cluster of skin-specific genes encoding secreted proteins.
15234001 2004 Identification of novel keratinocyte-secreted peptides dermokine-alpha/-beta and a new stratified epithelium-secreted protein gene complex on human chromosome 19q13.1.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12228223 2002 Suprabasin, a novel epidermal differentiation marker and potential cornified envelope precursor.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.