Property Summary

NCBI Gene PubMed Count 4
PubMed Score 57.80
PubTator Score 5.17

Knowledge Summary

Patent (1,293)

Expression

  Differential Expression (12)

Disease log2 FC p
osteosarcoma 1.105 2.1e-02
posterior fossa group B ependymoma -1.900 9.8e-10
glioblastoma -1.400 1.4e-02
non-small cell lung cancer 1.105 3.9e-09
adult high grade glioma -1.300 6.2e-03
group 4 medulloblastoma 1.500 7.5e-05
pilocytic astrocytoma -1.400 6.9e-07
subependymal giant cell astrocytoma -1.974 2.6e-02
Breast cancer 1.200 1.9e-08
ductal carcinoma in situ 1.700 1.1e-03
invasive ductal carcinoma 1.900 6.9e-04
pituitary cancer 1.100 2.5e-06

Synonym

Accession Q52WX2
Symbols SBK

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

  TechDev Info (1)

Gary Johnson 302 Kinome profile via MIB/MS Technology

Gene RIF (2)

PMID Text
21104019 Results suggest that the wide-spread expression pattern of human SBK1 may predict a broad cellular function, and its dysregulation in certain cancers suggests an involvement of the protein in the pathogenesis of human cancers.
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSVGCPEPEPPRSLTCCGPGTAPGPGAGVPLLTEDMQALTLRTLAASDVTKHYELVRELGKGTYGKVDLV      1 - 70
VYKGTGTKMALKFVNKSKTKLKNFLREVSITNSLSSSPFIIKVFDVVFETEDCYVFAQEYAPAGDLFDII     71 - 140
PPQVGLPEDTVKRCVQQLGLALDFMHGRQLVHRDIKPENVLLFDRECRRVKLADFGMTRRVGCRVKRVSG    141 - 210
TIPYTAPEVCQAGRADGLAVDTGVDVWAFGVLIFCVLTGNFPWEAASGADAFFEEFVRWQRGRLPGLPSQ    211 - 280
WRRFTEPALRMFQRLLALEPERRGPAKEVFRFLKHELTSELRRRPSHRARKPPGDRPPAAGPLRLEAPGP    281 - 350
LKRTVLTESGSGSRPAPPAVGSVPLPVPVPVPVPVPVPVPEPGLAPQGPPGRTDGRADKSKGQVVLATAI    351 - 420
EICV                                                                      421 - 424
//

Text Mined References (5)

PMID Year Title
21104019 2011 Human SBK1 is dysregulated in multiple cancers and promotes survival of ovary cancer SK-OV-3 cells.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
11322885 2001 Cloning and characterization of a novel serine/threonine protein kinase gene expressed predominantly in developing brain.