Property Summary

NCBI Gene PubMed Count 37
PubMed Score 68.88
PubTator Score 38.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.400 1.1e-15
breast carcinoma -1.200 5.6e-29
ductal carcinoma in situ -1.200 7.8e-04
intraductal papillary-mucinous adenoma (... -1.800 5.6e-04
intraductal papillary-mucinous carcinoma... -1.300 6.5e-04
invasive ductal carcinoma -1.070 1.6e-03
juvenile dermatomyositis 1.395 5.1e-10
osteosarcoma -1.368 4.1e-03
ovarian cancer -1.100 4.7e-05
Pick disease 1.600 8.1e-06
psoriasis -1.800 1.3e-03
tuberculosis -1.200 3.8e-06

Protein-protein Interaction (6)

Gene RIF (14)

AA Sequence

MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAFSTSGDVVSRN      1 - 70
QSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFF     71 - 140
DGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLPLPPGWSVDWT    141 - 210
MRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVT    211 - 280
YQPQQTERNQSLLVPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI    281 - 350
VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF                                         351 - 383
//

Text Mined References (40)

PMID Year Title