Property Summary

NCBI Gene PubMed Count 34
PubMed Score 63.28
PubTator Score 38.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.800 1.3e-03
osteosarcoma 2.035 3.9e-05
juvenile dermatomyositis 1.395 5.1e-10
tuberculosis and treatment for 3 months -1.300 5.1e-05
intraductal papillary-mucinous adenoma (... -1.800 5.6e-04
intraductal papillary-mucinous carcinoma... -1.400 6.8e-04
invasive ductal carcinoma -1.700 1.7e-03
Breast cancer -1.600 1.7e-20
breast carcinoma -1.200 5.6e-29
Pick disease 1.600 8.1e-06
ductal carcinoma in situ -1.200 7.8e-04
ovarian cancer -1.300 2.1e-05

Protein-protein Interaction (11)

Gene RIF (13)

PMID Text
25814670 using an Mst2 mutation that disrupts homotypic dimerization, we showed that the monomeric Mst2-SARAH domain could form a stable complex of 1:1 stoichiometric ratio with WW45 refolded under acidic pH.
25367221 MST1/2-SAV1 associates with the NPHP transition-zone complex, promoting ciliary localization of multiple ciliary cargoes.
23524264 Mst2 and the Ser-3 residue of human WW45 function independently of each other in the regulation of the stability of human WW45.
22570112 We also confirmed the interaction of HAX-1 and hSav1 in mammalian cells.
22185343 downregulation of SAV1 and the consequent YAP1 activation are involved in the pathogenesis of high-grade clear cell renal cell carcinoma.
21567072 hSav1 interacts with HAX1 and attenuates its protective role against apoptosis in MCF-7 breast cancer cells.
21489991 a role for Salvador as a human tumor suppressor and RASSF1A effector and show that Salvador allows RASSF1A to modulate p73 independently of the hippo pathway.
21104395 MST and hSAV act as novel co-regulators of ERalpha and may play an important role in breast cancer pathogenesis.
21076410 Study reports that two Hippo pathway components, Mst2 and the scaffold protein hSav1, directly interact with Nek2A and regulate its ability to localize to centrosomes, and phosphorylate C-Nap1 and rootletin.
19950692 hSav1 is a newly identified protein that interacts with Mst1 and augments Mst1-mediated apoptosis.
19212654 hWW45 is required to enhance MST1-mediated apoptosis in vivo and thus is a critical player in an MST1-driven cell death signaling pathway.
16930133 Together these results show that hSav can bind to, and be phosphorylated by, Mst, and that the stabilizing effect of Mst on hSav requires its interaction with hSav but is probably not due to phosphorylation of hSav by Mst.
12969014 Salvador gene is not frequently mutated in human carcinoma tissues.

AA Sequence

MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDICLPDSSPNAFSTSGDVVSRN      1 - 70
QSFLRTPIQRTPHEIMRRESNRLSAPSYLARSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFF     71 - 140
DGQRKRPLGDRAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLPLPPGWSVDWT    141 - 210
MRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGTYYVDHTNKKAQYRHPCAPSVPRYDQPPPVT    211 - 280
YQPQQTERNQSLLVPANPYHTAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI    281 - 350
VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF                                         351 - 383
//

Text Mined References (37)

PMID Year Title
25814670 2015 Low pH-driven folding of WW45-SARAH domain leads to stabilization of the WW45-Mst2 complex.
25367221 2014 The MST1/2-SAV1 complex of the Hippo pathway promotes ciliogenesis.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23524264 2013 A conserved serine residue regulates the stability of Drosophila Salvador and human WW domain-containing adaptor 45 through proteasomal degradation.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23386615 2013 The tumor suppressor Mst1 promotes changes in the cellular redox state by phosphorylation and inactivation of peroxiredoxin-1 protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22570112 2012 Screening of binding proteins that interact with human Salvador 1 in a human fetal liver cDNA library by the yeast two-hybrid system.
22185343 2011 Downregulation of SAV1 plays a role in pathogenesis of high-grade clear cell renal cell carcinoma.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21567072 2011 hSav1 interacts with HAX1 and attenuates its anti-apoptotic effects in MCF-7 breast cancer cells.
21489991 2011 Salvador protein is a tumor suppressor effector of RASSF1A with hippo pathway-independent functions.
21104395 2011 Mammalian MST2 kinase and human Salvador activate and reduce estrogen receptor alpha in the absence of ligand.
21076410 2010 Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20562859 2010 Network organization of the human autophagy system.
20303269 2010 Ajuba LIM proteins are negative regulators of the Hippo signaling pathway.
19950692 2009 [Overexpression of hSav1 promotes Mst1-induced apoptosis in HeLa cells].
19369195 2009 Large-scale proteomics analysis of the human kinome.
19212654 2009 The human WW45 protein enhances MST1-mediated apoptosis in vivo.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16930133 2006 Association of mammalian sterile twenty kinases, Mst1 and Mst2, with hSalvador via C-terminal coiled-coil domains, leads to its stabilization and phosphorylation.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15688006 2005 The Ste20-like kinase Mst2 activates the human large tumor suppressor kinase Lats1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12969014 2003 Mutational analysis of salvador gene in human carcinomas.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12202036 2002 salvador Promotes both cell cycle exit and apoptosis in Drosophila and is mutated in human cancer cell lines.
11027580 2000 Cloning, expression, and mapping of hWW45, a novel human WW domain-containing gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.