Property Summary

NCBI Gene PubMed Count 137
PubMed Score 219.70
PubTator Score 185.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.400 6.2e-04
astrocytic glioma -1.500 3.3e-02
Astrocytoma, Pilocytic -1.200 1.1e-02
atypical teratoid / rhabdoid tumor -2.700 3.0e-04
Breast cancer -2.100 8.8e-07
Chronic Lymphocytic Leukemia -1.126 1.5e-02
cystic fibrosis 1.247 1.2e-03
ependymoma -1.700 3.1e-07
glioblastoma -1.200 3.9e-04
interstitial cystitis -1.400 2.2e-03
intraductal papillary-mucinous adenoma (... -1.300 3.2e-02
intraductal papillary-mucinous carcinoma... -2.200 1.5e-02
lung cancer -1.400 1.7e-03
medulloblastoma -1.800 1.2e-04
medulloblastoma, large-cell -1.400 1.3e-03
osteosarcoma -1.749 3.5e-04
ovarian cancer -1.700 4.2e-08
pituitary cancer -2.700 8.4e-05
primitive neuroectodermal tumor -1.300 6.9e-03
tuberculosis and treatment for 6 months -1.300 4.7e-03
Waldenstrons macroglobulinemia -1.538 2.9e-03

Protein-protein Interaction (7)

Gene RIF (117)

AA Sequence

MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRK      1 - 70
GTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPV     71 - 140
PLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECP    141 - 210
LSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAE    211 - 280
QPPSPAQLSHGSQPSVRTPLPNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHP    281 - 350
PPVSRSMNKPLEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ    351 - 420
SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIATERNGKPENN    421 - 490
TMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSPENRTLWENLSMIRRFLSLPQ    491 - 560
PERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQQQQQQQQAPPPPQPQQQPQTGPRLPPRQPT    561 - 630
VASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYL    631 - 700
KHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD           701 - 763
//

Text Mined References (149)

PMID Year Title