Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.21
PubTator Score 82.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

AA Sequence

MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPC      1 - 70
VVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLY     71 - 140
KALGAQDLTEAEGWHFFCFQGEATRKLAGK                                            141 - 170
//

Text Mined References (22)

PMID Year Title