Property Summary

NCBI Gene PubMed Count 76
PubMed Score 409.46
PubTator Score 295.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

PDB (10)

Gene RIF (56)

AA Sequence

MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHS      1 - 70
IVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFY     71 - 140
KRRGASDLSSEEGWRLFKIDKEYLLKMATEE                                           141 - 171
//

Text Mined References (78)

PMID Year Title