Property Summary

NCBI Gene PubMed Count 22
PubMed Score 147.86
PubTator Score 110.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (12)

PMID Text
26999736 expression of wild-type centriolar assembly protein SAS-6 in a SAS-6-depleted background resulted in centriole sizes that are similar to wild type.
26422590 SAS6 possesses an intrinsic microtubule assembly promoting activity and its outer exposed C-terminal tail may play critical roles in microtubule assembly and stabilizing microtubule attachment with the centriolar cartwheel.
26035073 Our present findings revealed that the upregulation of SASS6 expression is involved in the pathogenesis of CRC and is associated with a poor prognosis among patients with colon cancer.
24951542 A homozygous c.185T>C missense mutation in the HsSAS-6 gene is associated with the cause of autosomal recessive primary microcephaly.
24590172 HsSAS-6 homodimers are targeted to centrosomes where the local environment and high concentration of HsSAS-6 promote oligomerization, thus initiating procentriole formation.
23511974 Authors propose that CEP135 directly connects the central hub protein, hSAS-6, to the outer microtubules, and suggest that this interaction stabilizes the proper cartwheel structure for further CPAP-mediated centriole elongation.
22349698 STIL cooperates with SAS-6 and PLK4 in the control of centriole number and represents a key centriole duplication factor in human cells.
22020124 hSAS6 depletion hindered STIL targeting to the procentriole, implying that STIL and hSAS6 are mutually dependent for their centriolar localization.
21725316 The activity of SCF-FBXW5 is negatively regulated by Polo-like kinase 4 (PLK4), which phosphorylates FBXW5 at Ser 151 to suppress its ability to ubiquitylate HsSAS-6.
19503075 Data show that depletion of hSAS-6 specifically inhibits the formation of CPAP-induced PLSs derived from procentrioles.
17681132 Regulated HsSAS-6 levels normally ensure that each centriole seeds the formation of a single procentriole per cell cycle, thus playing a fundamental role in driving the centrosome duplication cycle and ensuring genome integrity.
15665853 SAS-6 is required for daughter centriole formation in C. elegans. SAS-6 is a coiled-coil protein that is recruited to centrioles at the onset of the centrosome duplication cycle.

AA Sequence

MSQVLFHQLVPLQVKCKDCEERRVSIRMSIELQSVSNPVHRKDLVIRLTDDTDPFFLYNLVISEEDFQSL      1 - 70
KFQQGLLVDFLAFPQKFIDLLQQCTQEHAKEIPRFLLQLVSPAAILDNSPAFLNVVETNPFKHLTHLSLK     71 - 140
LLPGNDVEIKKFLAGCLKCSKEEKLSLMQSLDDATKQLDFTRKTLAEKKQELDKLRNEWASHTAALTNKH    141 - 210
SQELTNEKEKALQAQVQYQQQHEQQKKDLEILHQQNIHQLQNRLSELEAANKDLTERKYKGDSTIRELKA    211 - 280
KLSGVEEELQRTKQEVLSLRRENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQE    281 - 350
QKVVLEENGEKNQVQLGKLEATIKSLSAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEKLLAEKEE    351 - 420
KLQKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEESKQLLKNNEKLITWLNKELNENQLVRKQDVL    421 - 490
GPSTTPPAHSSSNTIRSGISPNLNVVDGRLTYPTCGIGYPVSSAFAFQNTFPHSISAKNTSHPGSGTKVQ    491 - 560
FNLQFTKPNASLGDVQSGATISMPCSTDKENGENVGLESKYLKKREDSIPLRGLSQNLFSNSDHQRDGTL    561 - 630
GALHTSSKPTALPSASSAYFPGQLPNS                                               631 - 657
//

Text Mined References (31)

PMID Year Title
26999736 2016 SAS-6 engineering reveals interdependence between cartwheel and microtubules in determining centriole architecture.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26422590 2015 Human SAS-6 C-Terminus Nucleates and Promotes Microtubule Assembly in Vitro by Binding to Microtubules.
26035073 2015 SASS6 overexpression is associated with mitotic chromosomal abnormalities and a poor prognosis in patients with colorectal cancer.
24951542 2014 A missense mutation in the PISA domain of HsSAS-6 causes autosomal recessive primary microcephaly in a large consanguineous Pakistani family.
24590172 2014 Mechanisms of HsSAS-6 assembly promoting centriole formation in human cells.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
23511974 2013 Human microcephaly protein CEP135 binds to hSAS-6 and CPAP, and is required for centriole assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349705 2012 STIL is required for centriole duplication in human cells.
22349698 2012 Cell-cycle-regulated expression of STIL controls centriole number in human cells.
22020124 2011 The human microcephaly protein STIL interacts with CPAP and is required for procentriole formation.
21725316 2011 The SCF-FBXW5 E3-ubiquitin ligase is regulated by PLK4 and targets HsSAS-6 to control centrosome duplication.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21273447 2011 Structures of SAS-6 suggest its organization in centrioles.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19503075 2009 CPAP is a cell-cycle regulated protein that controls centriole length.
19052644 2008 Role of CAP350 in centriolar tubule stability and centriole assembly.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17681132 2007 Regulated HsSAS-6 levels ensure formation of a single procentriole per centriole during the centrosome duplication cycle.
17681131 2007 Plk4-induced centriole biogenesis in human cells.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16244668 2005 The Polo kinase Plk4 functions in centriole duplication.
15665853 2005 SAS-6 defines a protein family required for centrosome duplication in C. elegans and in human cells.
15572125 2004 Centriole assembly requires both centriolar and pericentriolar material proteins.
14654843 2003 Proteomic characterization of the human centrosome by protein correlation profiling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.