Property Summary

NCBI Gene PubMed Count 42
PubMed Score 36.36
PubTator Score 113.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 2.100 7.8e-08
osteosarcoma -1.143 4.5e-04
astrocytoma 1.100 1.9e-02
medulloblastoma, large-cell 1.200 1.7e-05
juvenile dermatomyositis 1.142 5.9e-09
adrenocortical carcinoma 1.158 1.4e-03
tuberculosis -1.100 5.2e-05
lung cancer 1.100 4.6e-03
diabetes mellitus 2.900 1.5e-03
lung adenocarcinoma -1.100 9.2e-06
adult high grade glioma -1.200 4.0e-03
group 3 medulloblastoma 1.200 1.0e-02
Subcutaneous panniculitis-like T-cell ly... 1.500 1.1e-02
acute myeloid leukemia 3.100 4.7e-02
ovarian cancer 2.400 7.4e-06
dermatomyositis 1.100 1.2e-03

Pathway (1)

Gene RIF (18)

PMID Text
25939381 Hypoxia led to Tip110 protein degradation through the ubiquitin-proteasome system. Under hypoxia, Tip110 stabilized p53, which in return destabilized Tip110.
25928721 miR-124 regulates Tip110 expression and differentiation of human cord blood CD34(+) cells
24526689 SART3 recruits ubH2B, which may be evicted from DNA during transcription, for deubiquitination by Usp15
24316072 HIV-1 Tat complexes with LARP7, MEPCE, SART3, NPM1, PPM1G, hnRNP-F, and 7SK RNA to form a Tat-7SK RNP complex to control HIV-1 transcription
24217245 these findings have provided additional and mechanistic evidence to support Tip110 function in HIV-1 transcription.
24217245 HIV-1 Tat complexes with LARP7, MEPCE, SART3, NPM1, PPM1G, hnRNP-F, and 7SK RNA to form a Tat-7SK RNP complex to control HIV-1 transcription
23834120 Results identify a novel frameshift mutation in this gene implicated in disseminated superficial actinic porokeratosis in 4 Chinese families
23822148 YB-1 potentiates the Tip110/Tat-mediated transactivation of the HIV-1 LTR promoter.
23088399 findings show C-MYC upregulates transcription of TIP110 through interaction with the TIP110 E-box in the TIP110 promoter, ensuring high-level Tip110 expression in proliferating embryonic stem cells (hESCs); further show TIP110 regulates OCT4 alternative splicing in hESCs
22132941 TIP110 is also expressed in human embryonic stem cells (hESCs) and expression was decreased with differentiation of these ESCs.
19148489 Levels of anti-SART3 peptide antibody in prostate cancer patients are significantly higher than those of non-cancer subjects.
18567812 Both purified and recombinant LSm2-8 proteins are able to recruit p110 protein to U6 snRNA via interaction with the highly conserved C-terminal region of p110.
15314151 Data suggest a model whereby p110 (SART3) brings together U4 and U6 snRNAs through both RNA-protein and protein-protein interactions.
15031286 Tip110 is a negative regulator of AR transcriptional activation, and may be directly involved in AR-related developmental, physiological, and pathological processes
14749385 involvement of U6-p110 (SART3) in recycling of the U4atac/U6atac snRNP
12578909 Results suggest that U4 and U6 small nuclear ribonucleoproteins (snRNPs) accumulate in Cajal bodies for the purpose of assembly into U4/U6 snRNPs by SART3/p110.
11959860 HIV-1 Tat complexes with LARP7, MEPCE, SART3, NPM1, PPM1G, hnRNP-F, and 7SK RNA to form a Tat-7SK RNP complex to control HIV-1 transcription
11920522 detectable in majority of colorectal carcinoma tissues studied; could be an appropriate molecule for use in specific immunotherapy for colorectal carcinoma

AA Sequence

MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEEGVSESDGDEY      1 - 70
AMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIRLLRLEGELTKVRMARQKMSE     71 - 140
IFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDYICPNIWLEYGQYSVGGIGQKGGLEKVRSVF    141 - 210
ERALSSVGLHMTKGLALWEAYREFESAIVEAARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPES    211 - 280
VIQNYNKALQQLEKYKPYEEALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRY    281 - 350
SQYLDRQLKVKDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEI    351 - 420
WQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIEARLCNNMQ    421 - 490
KARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSDYPEHVCEVLLTMERTEGSLE    491 - 560
DWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQRKRARAEKKALKKKKKIRGPEKRGADEDDE    561 - 630
KEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSS    631 - 700
KDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSV    701 - 770
EGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKP    771 - 840
KGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLPQTYGARGKGR    841 - 910
TQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLFLRK                     911 - 963
//

Text Mined References (55)

PMID Year Title
25939381 2015 Tip110 Regulates the Cross Talk between p53 and Hypoxia-Inducible Factor 1? under Hypoxia and Promotes Survival of Cancer Cells.
25928721 2015 MicroRNA-124 Targets Tip110 Expression and Regulates Hematopoiesis.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24526689 2014 The U4/U6 recycling factor SART3 has histone chaperone activity and associates with USP15 to regulate H2B deubiquitination.
24217245 2014 Tip110 protein binds to unphosphorylated RNA polymerase II and promotes its phosphorylation and HIV-1 long terminal repeat transcription.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23834120 2013 Identification of three novel frameshift mutations of the MVK gene in four Chinese families with disseminated superficial actinic porokeratosis.
23822148 2013 Tip110 interacts with YB-1 and regulates each other's function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088399 2013 C-MYC controlled TIP110 protein expression regulates OCT4 mRNA splicing in human embryonic stem cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22132941 2012 Tip110 maintains expression of pluripotent factors in and pluripotency of human embryonic stem cells.
21447833 2011 TIP110/p110nrb/SART3/p110 regulation of hematopoiesis through CMYC.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20595234 2010 The Prp19 complex and the Usp4Sart3 deubiquitinating enzyme control reversible ubiquitination at the spliceosome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19148489 2009 Capability of SART3(109-118) peptide to induce cytotoxic T lymphocytes from prostate cancer patients with HLA class I-A11, -A31 and -A33 alleles.
18567812 2008 3'-cyclic phosphorylation of U6 snRNA leads to recruitment of recycling factor p110 through LSm proteins.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932509 2007 Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.
17643375 2007 Systematic analysis of the protein interaction network for the human transcription machinery reveals the identity of the 7SK capping enzyme.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15840095 2005 A mutation in SART3 gene in a Chinese pedigree with disseminated superficial actinic porokeratosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452143 2004 Detection of snRNP assembly intermediates in Cajal bodies by fluorescence resonance energy transfer.
15314151 2004 Human U4/U6 snRNP recycling factor p110: mutational analysis reveals the function of the tetratricopeptide repeat domain in recycling.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15031286 2004 Tip110, the human immunodeficiency virus type 1 (HIV-1) Tat-interacting protein of 110 kDa as a negative regulator of androgen receptor (AR) transcriptional activation.
14749385 2004 Recycling of the U12-type spliceosome requires p110, a component of the U6atac snRNP.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12578909 2003 Targeting of U4/U6 small nuclear RNP assembly factor SART3/p110 to Cajal bodies.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12374753 2002 Hierarchical, clustered protein interactions with U4/U6 snRNA: a biochemical role for U4/U6 proteins.
12032085 2002 p110, a novel human U6 snRNP protein and U4/U6 snRNP recycling factor.
11959860 2002 HIV-1 Tat protein-mediated transactivation of the HIV-1 long terminal repeat promoter is potentiated by a novel nuclear Tat-interacting protein of 110 kDa, Tip110.
11920522 2002 Expression of tumor rejection antigens in colorectal carcinomas.
11477570 2001 Binding of a SART3 tumor-rejection antigen to a pre-mRNA splicing factor RNPS1: a possible regulation of splicing by a complex formation.
11092984 2000 Expression of tumor-rejection antigens in gynecologic cancers.
10844547 2000 Identification of a locus for disseminated superficial actinic porokeratosis at chromosome 12q23.2-24.1.
10761712 2000 Mouse homologue of the human SART3 gene encoding tumor-rejection antigen.
10463607 1999 Identification of a gene coding for a protein possessing shared tumor epitopes capable of inducing HLA-A24-restricted cytotoxic T lymphocytes in cancer patients.
8590280 1995 Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.