Property Summary

NCBI Gene PubMed Count 21
PubMed Score 81.84
PubTator Score 33.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 2.6e-05
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.603 2.6e-05

Gene RIF (5)

AA Sequence

MATETVELHKLKLAELKQECLARGLETKGIKQDLIHRLQAYLEEHAEEEANEEDVLGDETEEEETKPIEL      1 - 70
PVKEEEPPEKTVDVAAEKKVVKITSEIPQTERMQKRAERFNVPVSLESKKAARAARFGISSVPTKGLSSD     71 - 140
NKPMVNLDKLKERAQRFGLNVSSISRKSEDDEKLKKRKERFGIVTSSAGTGTTEDTEAKKRKRAERFGIA    141 - 210
//

Text Mined References (24)

PMID Year Title