Property Summary

NCBI Gene PubMed Count 21
PubMed Score 79.69
PubTator Score 50.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Chylomicron retention disease 11 0.0 5.0
Disease Target Count Z-score Confidence
Lipid metabolism disorder 111 4.454 2.2
Vitreous detachment 10 3.062 1.5

Expression

  Differential Expression (17)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 3.0e-05
autosomal dominant Emery-Dreifuss muscul... -1.077 5.3e-03
breast carcinoma 1.100 3.2e-18
cutaneous lupus erythematosus 1.100 1.4e-03
cystic fibrosis -1.100 4.5e-04
Duchenne muscular dystrophy -1.124 1.3e-06
hereditary spastic paraplegia -1.479 1.0e-03
lung adenocarcinoma 1.266 6.3e-07
medulloblastoma, large-cell -1.100 4.9e-04
Multiple myeloma 1.107 1.0e-02
ovarian cancer -1.800 2.1e-09
pancreatic cancer 1.200 1.8e-02
pancreatic carcinoma 1.200 1.8e-02
pancreatic ductal adenocarcinoma liver m... -3.251 2.3e-04
psoriasis 1.400 4.4e-04
sonic hedgehog group medulloblastoma -1.100 1.3e-03
tuberculosis -1.100 8.8e-06

Gene RIF (11)

AA Sequence

MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT      1 - 70
FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE     71 - 140
AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID                141 - 198
//

Text Mined References (25)

PMID Year Title