Property Summary

NCBI Gene PubMed Count 28
PubMed Score 12.00
PubTator Score 203.72

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.535 2.4e-03
psoriasis -1.200 2.8e-03
osteosarcoma -1.179 3.7e-03
cystic fibrosis 1.700 4.6e-04
glioblastoma 1.700 1.6e-03
primary pancreatic ductal adenocarcinoma 1.005 8.7e-03
pediatric high grade glioma 1.100 7.7e-05
Polycystic Ovary Syndrome 1.120 4.7e-02
Breast cancer 1.300 9.9e-12
ovarian cancer -1.700 3.1e-06

Gene RIF (15)

PMID Text
26607390 SAR1A gene silencing in hepatocytes mimics the effect of ethanol: dedimerization of giantin, arresting PDIA3 in the endoplasmic reticulum (ER) and large-scale alterations in Golgi architecture.
24914133 Data indicate that hydroxyurea (HU) induces SAR1 protein expression, which in turn activates gamma-globin expression, predominantly through the Gialpha/JNK/Jun pathway.
24338480 although Sar1A antagonizes the lipoprotein secretion-promoting activity of Sar1B, both isoforms modulate the expression of genes encoding cholesterol biosynthetic enzymes and the synthesis of cholesterol de novo.
23019651 Sedlin bound and promoted efficient cycling of Sar1, a guanosine triphosphatase that can constrict membranes, and thus allowed nascent carriers to grow and incorporate procollagen prefibrils.
22974979 the behavior of the human of Sar1A and Sar1B, a key component of the COPII family of vesicle coat proteins, was examined.
22605651 Sar1 mutant proteins added to metaphase-arrested Xenopus laevis egg extracts cause dramatic effects on membrane organization.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20624903 lipid-directed and tether-assisted Sar1 organization controls membrane constriction to regulate ER export.
20457124 the intracellular trafficking of hCaR from the endoplasmic reticulum is Sar1-dependent via coat protein complex-II vesicles.
19357197 Kir6.2 contains a di-acidic endoplasmic reticulum exit signal, which promotes endoplasmic reticulum exit via a process that requires Sar1.
19135528 Sar 1 H79G mutants efficiently blocked the plasma membrane trafficking of the Kir3.1/Kir3.4 complex however they did not block the Gbeta1gamma2/Kir3.1 interaction.
18318767 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17981133 The Sec31 fragment stimulates GAP activity of Sec23/24, and a convergence of Sec31 and Sec23 residues at the Sar1 GTPase active site explains how GTP hydrolysis is triggered leading to COPII coat disassembly.
17373700 Observational study of gene-disease association. (HuGE Navigator)
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT      1 - 70
FTTFDLGGHEQARRVWKNYLPAINGIVFLVDCADHSRLVESKVELNALMTDETISNVPILILGNKIDRTD     71 - 140
AISEEKLREIFGLYGQTTGKGNVTLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID                141 - 198
//

Text Mined References (37)

PMID Year Title
26607390 2015 Downregulation of the small GTPase SAR1A: a key event underlying alcohol-induced Golgi fragmentation in hepatocytes.
26522472 2015 Germline Heterozygous Variants in SEC23B Are Associated with Cowden Syndrome and Enriched in Apparently Sporadic Thyroid Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24914133 2014 Hydroxyurea-inducible SAR1 gene acts through the Gi?/JNK/Jun pathway to regulate ?-globin expression.
24338480 2014 The endoplasmic reticulum coat protein II transport machinery coordinates cellular lipid secretion and cholesterol biosynthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23019651 2012 Sedlin controls the ER export of procollagen by regulating the Sar1 cycle.
22974979 2012 Modulation of membrane rigidity by the human vesicle trafficking proteins Sar1A and Sar1B.
22605651 2012 Altering membrane topology with Sar1 does not impair spindle assembly in Xenopus egg extracts.
21269460 2011 Initial characterization of the human central proteome.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20624903 2010 Sar1 assembly regulates membrane constriction and ER export.
20457124 2010 Sar1-dependent trafficking of the human calcium receptor to the cell surface.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19357197 2009 Sar1-GTPase-dependent ER exit of KATP channels revealed by a mutation causing congenital hyperinsulinism.
19181664 2009 Distinct transport and intracellular activities of two GlcAT-P isoforms.
19135528 2009 Intracellular trafficking and assembly of specific Kir3 channel/G protein complexes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318767 2008 Fetal haemoglobin response to hydroxycarbamide treatment and sar1a promoter polymorphisms in sickle cell anaemia.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981133 2007 Insights into COPII coat nucleation from the structure of Sec23.Sar1 complexed with the active fragment of Sec31.
17373700 2007 Association studies of 23 positional/functional candidate genes on chromosome 10 in late-onset Alzheimer's disease.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17005010 2006 Sec16 defines endoplasmic reticulum exit sites and is required for secretory cargo export in mammalian cells.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12692552 2003 Mutations in a Sar1 GTPase of COPII vesicles are associated with lipid absorption disorders.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10871277 2000 Inhibitors of COPI and COPII do not block PEX3-mediated peroxisome synthesis.