Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.04
PubTator Score 4.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric cancer 1.500 3.1e-04
hepatocellular carcinoma 1.300 7.3e-07
osteosarcoma -1.155 3.7e-03
atypical teratoid / rhabdoid tumor -1.200 4.5e-04
glioblastoma -1.200 4.3e-03
medulloblastoma, large-cell -1.400 7.3e-03
non-small cell lung cancer -1.058 2.2e-13
subependymal giant cell astrocytoma -1.279 1.7e-02
invasive ductal carcinoma -1.600 6.8e-04
ovarian cancer -2.300 1.7e-06

Gene RIF (4)

PMID Text
20588308 Observational study of gene-disease association. (HuGE Navigator)
19015240 findings demonstrate new functions for SAP30L and SAP30 by showing that they can associate directly with core histones as well as naked DNA
18070604 transcriptional repression mediated by SAP30L can be influenced by alternative mRNA splicing
14680513 SAP30L, a nuclear protein, is upregulated by transforming growth factor-beta in intestinal epithelial cells

AA Sequence

MNGFSTEEDSREGPPAAPAAAAPGYGQSCCLIEDGERCVRPAGNASFSKRVQKSISQKKLKLDIDKSVRH      1 - 70
LYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHDTDIPEVDLFQLQVNTLRRYKRHYKLQTRPGFNKAQLA     71 - 140
ETVSRHFRNIPVNEKETLAYFIYMVKSNKSRLDQKSEGGKQLE                               141 - 183
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25035420 2014 Identification of three novel genetic variations associated with electrocardiographic traits (QRS duration and PR interval) in East Asians.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19015240 2009 DNA-binding and -bending activities of SAP30L and SAP30 are mediated by a zinc-dependent module and monophosphoinositides.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18070604 2008 Alternative mRNA splicing of SAP30L regulates its transcriptional repression activity.
16820529 2006 SAP30L interacts with members of the Sin3A corepressor complex and targets Sin3A to the nucleolus.
16484223 2006 FEZ1 dimerization and interaction with transcription regulatory proteins involves its coiled-coil region.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14680513 2003 TGF-beta induces the expression of SAP30L, a novel nuclear protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10843801 2000 Transcription mapping of the 5q- syndrome critical region: cloning of two novel genes and sequencing, expression, and mapping of a further six novel cDNAs.