Property Summary

NCBI Gene PubMed Count 16
PubMed Score 29.25
PubTator Score 5.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Schizophrenia 503
Disease Target Count Z-score Confidence
Hypertensive retinopathy 9 3.973 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.439 1.6e-04
posterior fossa group B ependymoma 1.400 1.4e-08
non primary Sjogren syndrome sicca 1.100 3.8e-02
ovarian cancer 1.500 2.5e-05

Gene RIF (5)

PMID Text
26350878 Two SNPs were significantly associated with rotator cuff tearing, residing in SAP30BP on chromosome 17 and SASH1 on chromosome 6.
21221920 The results indicate that HTRP could inhibit the transcription of a viral promoter, whose interaction with SAP30 synergistically affects transcriptional inhibition of the herpes simplex virus type 1 genes, and is related to HDAC enzyme activity.
20532202 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of SAP30 binding protein (SAP30BP) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
15496587 HTRP is involved in cellular co-repressors

AA Sequence

MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSR      1 - 70
QSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYE     71 - 140
RKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDK    141 - 210
LEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPA    211 - 280
VVTVTTSASGSKTTVISAVGTIVKKAKQ                                              281 - 308
//

Text Mined References (25)

PMID Year Title
26350878 2016 Genome-wide association study for rotator cuff tears identifies two significant single-nucleotide polymorphisms.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21822266 2011 Exome sequencing supports a de novo mutational paradigm for schizophrenia.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21221920 2010 Transcriptional regulation by HSV-1 induced HTRP via acetylation system.
20532202 2010 Use of genome-wide expression data to mine the "Gray Zone" of GWA studies leads to novel candidate obesity genes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18255255 2008 A protein-protein interaction network of transcription factors acting during liver cell proliferation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15496587 2004 HTRP--an immediate-early gene product induced by HSV1 infection in human embryo fibroblasts, is involved in cellular co-repressors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
9651585 1998 SAP30, a novel protein conserved between human and yeast, is a component of a histone deacetylase complex.