Property Summary

NCBI Gene PubMed Count 21
PubMed Score 14.27
PubTator Score 9.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Multiple myeloma 1.155 8.9e-04
psoriasis -1.500 1.5e-03
osteosarcoma -1.753 1.7e-03
atypical teratoid / rhabdoid tumor -1.300 3.0e-06
glioblastoma -1.100 8.6e-03
medulloblastoma, large-cell -1.500 2.0e-04
non-small cell lung cancer -1.364 1.2e-22
lung cancer -1.400 3.3e-04
adult high grade glioma -1.200 6.6e-04
non primary Sjogren syndrome sicca 1.100 4.3e-02
lung adenocarcinoma -1.100 7.3e-07
invasive ductal carcinoma -1.200 1.7e-02
ovarian cancer -1.700 2.7e-04
dermatomyositis 1.400 1.8e-03

Gene RIF (7)

PMID Text
25921304 These studies indicated that SAP18 expression enhanced the recruitment of mSin3A in coordination with TRIB1 to MTTP regulatory elements and increased MTTP expression.
25416801 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells
23799881 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells
20966198 A novel function of SAP18 in splicing regulation.
19503603 study indicates HIV-1 integrase & INI1/hSNF5 bind SAP18 & recruit components of Sin3a-HDAC1 complex into HIV-1 virions; HIV-1 virion-associated HDAC1 is required for efficient early post-entry events, indicating novel role for HDAC1 in HIV-1 replication
19503603 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells
19454010 SAP18 (Sin3A-associated protein, 18kDa) enhances HIV-1 Tat transactivation activity in HEK293 cells

AA Sequence

MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELT      1 - 70
SLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPP     71 - 140
NRAPPPSGRMRPY                                                             141 - 153
//

Text Mined References (27)

PMID Year Title
25921304 2015 Sin3A-associated protein, 18 kDa, a novel binding partner of TRIB1, regulates MTTP expression.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22203037 2012 Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
21269460 2011 Initial characterization of the human central proteome.
20966198 2010 Human SAP18 mediates assembly of a splicing regulatory multiprotein complex via its ubiquitin-like fold.
19503603 2009 Recruitment of a SAP18-HDAC1 complex into HIV-1 virions and its requirement for viral replication.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17002296 2006 Structure of SAP18: a ubiquitin fold in histone deacetylase complex assembly.
16537548 2006 Loss of Acinus inhibits oligonucleosomal DNA fragmentation but not chromatin condensation during apoptosis.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16314458 2005 Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665594 2003 ASAP, a novel protein complex involved in RNA processing and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10357820 1999 Repression by Ikaros and Aiolos is mediated through histone deacetylase complexes.
9150135 1997 Histone deacetylases and SAP18, a novel polypeptide, are components of a human Sin3 complex.