| Tbio | SAM domain-containing protein SAMSN-1 |
Negative regulator of B-cell activation. Down-regulates cell proliferation (in vitro). Promotes RAC1-dependent membrane ruffle formation and reorganization of the actin cytoskeleton. Regulates cell spreading and cell polarization. Stimulates HDAC1 activity. Regulates LYN activity by modulating its tyrosine phosphorylation (By similarity).
SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]).[supplied by OMIM, Mar 2008]
SAMSN1 is a member of a novel gene family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains (Claudio et al., 2001 [PubMed 11536050]).[supplied by OMIM, Mar 2008]
Comments
| Disease | Target Count |
|---|---|
| IGA Glomerulonephritis | 454 |
| Disease | Target Count | P-value |
|---|---|---|
| psoriasis | 6685 | 1.1e-79 |
| periodontitis | 269 | 1.7e-19 |
| non-small cell lung cancer | 2798 | 7.8e-10 |
| ulcerative colitis | 2087 | 1.2e-07 |
| lung carcinoma | 2844 | 6.0e-07 |
| interstitial cystitis | 2299 | 7.6e-07 |
| malignant mesothelioma | 3163 | 6.5e-06 |
| pilocytic astrocytoma | 3086 | 1.5e-05 |
| lung cancer | 4473 | 1.5e-05 |
| tuberculosis | 1563 | 8.9e-05 |
| glioblastoma | 5572 | 1.4e-04 |
| ovarian cancer | 8491 | 6.1e-04 |
| primary Sjogren syndrome | 788 | 6.6e-04 |
| cutaneous lupus erythematosus | 1056 | 6.9e-04 |
| pediatric high grade glioma | 2712 | 4.2e-03 |
| intraductal papillary-mucinous carcinoma (IPMC) | 2988 | 4.8e-03 |
| posterior fossa group A ependymoma | 1511 | 7.8e-03 |
| Atopic dermatitis | 944 | 1.1e-02 |
| Rheumatoid Arthritis | 1170 | 1.2e-02 |
| group 4 medulloblastoma | 1875 | 1.3e-02 |
| invasive ductal carcinoma | 2950 | 2.0e-02 |
| medulloblastoma, large-cell | 6234 | 2.9e-02 |
| aldosterone-producing adenoma | 664 | 3.3e-02 |
| intraductal papillary-mucinous adenoma (IPMA) | 2956 | 4.3e-02 |
| Disease | Target Count | Z-score | Confidence |
|---|---|---|---|
| Monoclonal gammopathy of uncertain significance | 5 | 3.028 | 1.5 |
| Disease | log2 FC | p |
|---|---|---|
| Rheumatoid Arthritis | 1.600 | 1.2e-02 |
| malignant mesothelioma | -1.500 | 6.5e-06 |
| cutaneous lupus erythematosus | 3.000 | 6.9e-04 |
| glioblastoma | 3.600 | 1.4e-04 |
| periodontitis | 1.300 | 1.7e-19 |
| group 4 medulloblastoma | -1.400 | 1.3e-02 |
| medulloblastoma, large-cell | -1.700 | 2.9e-02 |
| Atopic dermatitis | 1.500 | 1.1e-02 |
| tuberculosis | -2.200 | 8.9e-05 |
| non-small cell lung cancer | -1.418 | 7.8e-10 |
| intraductal papillary-mucinous adenoma (... | -1.600 | 4.3e-02 |
| intraductal papillary-mucinous carcinoma... | -2.200 | 4.8e-03 |
| lung cancer | -3.400 | 1.5e-05 |
| interstitial cystitis | 2.600 | 7.6e-07 |
| pediatric high grade glioma | 1.900 | 4.2e-03 |
| pilocytic astrocytoma | 2.000 | 1.5e-05 |
| posterior fossa group A ependymoma | 1.300 | 7.8e-03 |
| primary Sjogren syndrome | 2.700 | 6.6e-04 |
| aldosterone-producing adenoma | -1.173 | 3.3e-02 |
| psoriasis | 1.800 | 1.1e-79 |
| invasive ductal carcinoma | 2.125 | 2.0e-02 |
| lung carcinoma | -1.500 | 6.0e-07 |
| ulcerative colitis | 4.000 | 1.2e-07 |
| ovarian cancer | 2.100 | 6.1e-04 |
| PMID | Text | |
|---|---|---|
| 25805236 | Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma. | |
| 25117979 | This is the first study to identify deletion of a key gene in the C57BL/KaLwRij mice that also displays reduced gene expression in patients with MM and is therefore likely to play an integral role in MM disease development. | |
| 24278465 | High expression of SAMSN1 is a significant risk factor for the progression free and overall survival of glioblastoma multiforme | |
| 21296879 | the immunoinhibitory roles of SLy2 in vivo and suggest that the physiological up-regulation of SLy2 observed upon B cell activation functions to counteract excessive B cell spreading. | |
| 20478393 | In the nucleus, SLy2 interacts with the SAP30/HDAC1 complex and regulates the activity of HDAC1. | |
| 20379614 | Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) | |
| 18523997 | downregulation of SAMSN1 gene in human lung cancer. | |
| 15381729 | HACS1 is up-regulated by B cell activation signals and is a participant in B cell activation and differentiation. |
MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKM 1 - 70 RAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGIT 71 - 140 SCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNK 141 - 210 VGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESH 211 - 280 LIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNG 281 - 350 KEDLESENLSDMVHKIIITEPSD 351 - 373 //
| PMID | Year | Title | |
|---|---|---|---|
| 25805236 | 2015 | Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma. | |
| 25378659 | 2015 | Genetic loci associated with circulating levels of very long-chain saturated fatty acids. | |
| 25117979 | 2014 | SAMSN1 is a tumor suppressor gene in multiple myeloma. | |
| 24278465 | 2013 | SAMSN1 is highly expressed and associated with a poor survival in glioblastoma multiforme. | |
| 23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. | |
| 22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. | |
| 21296879 | 2011 | Immunoinhibitory adapter protein Src homology domain 3 lymphocyte protein 2 (SLy2) regulates actin dynamics and B cell spreading. | |
| 21269460 | 2011 | Initial characterization of the human central proteome. | |
| 20478393 | 2010 | SLy2 targets the nuclear SAP30/HDAC1 complex. | |
| 20379614 | Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score. | ||
| 19807924 | 2009 | Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening. | |
| 18523997 | 2008 | Detailed characterization of a homozygously deleted region corresponding to a candidate tumor suppressor locus at 21q11-21 in human lung cancer. | |
| 16344560 | 2006 | Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15381729 | 2004 | The SH3-SAM adaptor HACS1 is up-regulated in B cell activation signaling cascades. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12909339 | 2003 | Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 11594764 | 2001 | Identification of Nash1, a novel protein containing a nuclear localization signal, a sterile alpha motif, and an SH3 domain preferentially expressed in mast cells. | |
| 11536050 | 2001 | HACS1 encodes a novel SH3-SAM adaptor protein differentially expressed in normal and malignant hematopoietic cells. | |
| 10830953 | 2000 | The DNA sequence of human chromosome 21. |
