Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.03
PubTator Score 193.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Rheumatoid Arthritis 1.600 1.2e-02
malignant mesothelioma -1.500 6.5e-06
cutaneous lupus erythematosus 3.000 6.9e-04
glioblastoma 3.600 1.4e-04
periodontitis 1.300 1.7e-19
group 4 medulloblastoma -1.400 1.3e-02
medulloblastoma, large-cell -1.700 2.9e-02
Atopic dermatitis 1.500 1.1e-02
tuberculosis -2.200 8.9e-05
non-small cell lung cancer -1.418 7.8e-10
intraductal papillary-mucinous adenoma (... -1.600 4.3e-02
intraductal papillary-mucinous carcinoma... -2.200 4.8e-03
lung cancer -3.400 1.5e-05
interstitial cystitis 2.600 7.6e-07
pediatric high grade glioma 1.900 4.2e-03
pilocytic astrocytoma 2.000 1.5e-05
posterior fossa group A ependymoma 1.300 7.8e-03
primary Sjogren syndrome 2.700 6.6e-04
aldosterone-producing adenoma -1.173 3.3e-02
psoriasis 1.800 1.1e-79
invasive ductal carcinoma 2.125 2.0e-02
lung carcinoma -1.500 6.0e-07
ulcerative colitis 4.000 1.2e-07
ovarian cancer 2.100 6.1e-04

Gene RIF (8)

PMID Text
25805236 Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.
25117979 This is the first study to identify deletion of a key gene in the C57BL/KaLwRij mice that also displays reduced gene expression in patients with MM and is therefore likely to play an integral role in MM disease development.
24278465 High expression of SAMSN1 is a significant risk factor for the progression free and overall survival of glioblastoma multiforme
21296879 the immunoinhibitory roles of SLy2 in vivo and suggest that the physiological up-regulation of SLy2 observed upon B cell activation functions to counteract excessive B cell spreading.
20478393 In the nucleus, SLy2 interacts with the SAP30/HDAC1 complex and regulates the activity of HDAC1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18523997 downregulation of SAMSN1 gene in human lung cancer.
15381729 HACS1 is up-regulated by B cell activation signals and is a participant in B cell activation and differentiation.

AA Sequence

MLKRKPSNVSEKEKHQKPKRSSSFGNFDRFRNNSLSKPDDSTEAHEGDPTNGSGEQSKTSNNGGGLGKKM      1 - 70
RAISWTMKKKVGKKYIKALSEEKDEEDGENAHPYRNSDPVIGTHTEKVSLKASDSMDSLYSGQSSSSGIT     71 - 140
SCSDGTSNRDSFRLDDDGPYSGPFCGRARVHTDFTPSPYDTDSLKIKKGDIIDIICKTPMGMWTGMLNNK    141 - 210
VGNFKFIYVDVISEEEAAPKKIKANRRSNSKKSKTLQEFLERIHLQEYTSTLLLNGYETLEDLKDIKESH    211 - 280
LIELNIENPDDRRRLLSAAENFLEEEIIQEQENEPEPLSLSSDISLNKSQLDDCPRDSGCYISSGNSDNG    281 - 350
KEDLESENLSDMVHKIIITEPSD                                                   351 - 373
//

Text Mined References (21)

PMID Year Title
25805236 2015 Suppression of SAMSN1 Expression is Associated with the Malignant Phenotype of Hepatocellular Carcinoma.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25117979 2014 SAMSN1 is a tumor suppressor gene in multiple myeloma.
24278465 2013 SAMSN1 is highly expressed and associated with a poor survival in glioblastoma multiforme.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21296879 2011 Immunoinhibitory adapter protein Src homology domain 3 lymphocyte protein 2 (SLy2) regulates actin dynamics and B cell spreading.
21269460 2011 Initial characterization of the human central proteome.
20478393 2010 SLy2 targets the nuclear SAP30/HDAC1 complex.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19807924 2009 Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening.
18523997 2008 Detailed characterization of a homozygously deleted region corresponding to a candidate tumor suppressor locus at 21q11-21 in human lung cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381729 2004 The SH3-SAM adaptor HACS1 is up-regulated in B cell activation signaling cascades.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12909339 2003 Juxtacentromeric region of human chromosome 21: a boundary between centromeric heterochromatin and euchromatic chromosome arms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11594764 2001 Identification of Nash1, a novel protein containing a nuclear localization signal, a sterile alpha motif, and an SH3 domain preferentially expressed in mast cells.
11536050 2001 HACS1 encodes a novel SH3-SAM adaptor protein differentially expressed in normal and malignant hematopoietic cells.
10830953 2000 The DNA sequence of human chromosome 21.