Property Summary

NCBI Gene PubMed Count 115
PubMed Score 8199.43
PubTator Score 163.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Aicardi-Goutieres syndrome 5 1

Expression

Gene RIF (129)

PMID Text
26779819 Therefore, our findings revealed that factors in addition to Vpx-SAMHD1 binding influence the efficiency of Vpx-mediated SAMHD1 degradation.
26733158 The SAMHD1 restricts HIV-1 infection in non-cycling cells by limiting the pool of deoxyribonucleoside triphosphates, thereby interfering with HIV-1 reverse transcription.
26655245 These results argue against a requirement for additional myeloid-specific host factors for SAMHD1 function but further support the notion that SAMHD1 possesses an additional dNTP-independent function contributing to lentiviral restriction.
26606981 SAMHD1 may facilitate some aspects of THP-1 cell differentiation.
26504826 Studied whether one or more SAMHD1 gene mutations are associated with cerebrovascular disease in the general population using a Chinese stroke cohort.
26431200 SAMHD1 phosphorylation also ablates restriction and tetramer formation but without affecting triphosphohydrolase steady-state kinetics
26416562 This review summarizes the latest advances in understanding the importance of dNTP metabolism in cancer development and the novel function of SAMHD1 in regulating this process.
26397446 Interferonstimulated gene factor 3 complex, which consists of STAT1, STAT2 and IRF9, is required for the induction of SAMHD1 expression by IFN-alpha in SMMC-7721 cells.
26342080 results prove the importance of SAMHD1 in the regulation of all dNTP pools and suggest that dGK inside mitochondria has the function of recycling the deoxyguanosine derived from endogenous dGTP degraded by SAMHD1 in the nucleus
26294762 The phosphomimetic mutation results in a significant decrease in the population of active SAMHD1 tetramers, and hence the dNTPase activity is substantially decreased.
26032178 The results presented herein suggest that the RNase activity of SAMHD1 is sufficient to control the replication of retroviruses, but not that of non-retro RNA viruses.
26032178 HIV-1 replication is restricted by SAMHD1 in monocyte-derived macrophage-like cells (PMA-treated U937 cells)
25996507 Data suggest that critical role of vpx (Simian immunodeficiency virus vpx protein) in vivo/in vitro is to promote degradation of SAMHD1 in memory CD4+ T-lymphocytes, thereby generating high levels of plasma viremia and induction of immunodeficiency.
25936766 Data indicate that proline residue P109 within the C-terminal poly-proline motif (PPM) of Vpx protein plays a unique role in the regulation of SAM domain and HD domain 1 protein SAMHD1 degradation.
25926647 These results demonstrate that the antiviral activity of SAMHD1 impacts HIV-1 antigen presentation by dendritic cells, highlighting the link that exists between restriction factors and adaptive immune responses.
25926647 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
25890101 increased SAMHD1 in human astrocytes is in part responsible for the HIV restriction, silencing of which relieves this restriction
25825449 HIV-1 replication does not trigger immune activation in DCs, but that HIV-1 escapes immune surveillance by actively suppressing DC maturation independent of SAMHD1.
25762741 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
25760601 the level of dNTP pools is elegantly regulated by the self-sensing ability of SAMHD1 through a novel activation mechanism.
25715102 CD4 T-cell subsets known to be more susceptible to HIV-1 infection, for example, T-helper 17 and follicular helper T cells, display lower levels of SAMHD1.
25715102 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
25646359 study establishes the first cross-sectional protein expression profile of SAMHD1 in human tissues and provides insight into its cell cycle-dependent phosphorylation and unresponsiveness to multiple proinflammatory cytokines
25532805 Therefore, cyclin L2-mediated control of SAMHD1 levels in macrophages supports HIV-1 replication.
25524560 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
25449277 SAMHD1 promoter is highly methylated in lung adenocarcinoma, which may inhibit its gene expression; over-expression of SAMHD1 reduces dNTP level and inhibits the proliferation of lung tumor cells
25423367 eEF1A1 may mediate SAMHD1 turnover by targeting it to the proteosome for degradation through association with Cullin4A and Rbx1.
25392215 Authors report for the first time that macrophages are one of the main HIV-1 target cells in the endometrium and that infection of macrophages from both the endometrium and the decidua is restricted by SAMHD1
25288794 Data indicate that sterile alpha motif and histidine-aspartate domain-containing protein 1 (SAMHD1) forms a tetramer with GTP and dNTPs and exhibits enzymatic activity.
25267621 These data demonstrate how SAMHD1 is activated by binding of GTP or dGTP at allosteric site 1 and a dNTP of any type at allosteric site 2.
25201733 miR-181 regulates the level of post-transcriptional SAMHD1 expression negatively by directly binding to the 3'UTR in SAMHD1.
25063780 SAMHD1 plays a role in controlling virus replication in HIV+ individuals.
25038827 the RNase activity of SAMHD1 is responsible for preventing HIV-1 infection by directly degrading the HIV-1 RNA.
25019997 findings suggested that IFN-alpha-inducible SAMHD1 inhibited HBV replication in liver cells
25015816 these findings identify a direct relationship between control of the cell cycle by CDK6 and SAMHD1 activity, which is important for replication of lentiviruses, as well as other viruses whose replication may be regulated by intracellular dNTP availability.
25010268 All studied SAMHD1 variants block HIV-1 and HIV-2 infection.
24913159 HIV-1 replication is restricted by SAMHD1 in monocyte-derived macrophage-like cells (PMA-treated U937 cells)
24828500 Allosteric regulation by dATP and dTTP works similarly in human and mouse SAMHD1.
24772904 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24753578 SAMHD1 can remain active long after dNTP pools have been reduced to a level that would lead to inactivation. This property would be important in resting CD4(+) T cells, where dNTP pools are reduced to nanomolar levels to restrict infection by HIV-1.
24712655 This work extends published observations on SAMHD1 nuclear localization to a natural cell type for HIV-1 infection and identifies KPNA2/KPNB1 as cellular proteins important for SAMHD1 nuclear import.
24623419 Authors identified and validated two additional host proteins interacting with human SAMHD1, namely, cyclin-dependent kinase 2 (CDK2) and S-phase kinase-associated protein 2 (SKP2).
24599229 These results indicated that SAMHD1 moderately restricts even a macrophage-tropic HIV-1 strain in monocyte-derived macrophages.
24574390 These results demonstrate that cross talk with lymphocytes downregulates SAMHD1 expression in dendritic cells, triggering HIV-1 replication and an antiviral immune response.
24554663 CD4(+) memory T cells with stem cell-like properties are targets for HIV infection, become productively or latently infected at low levels, and SAMHD1 expression promotes abortive infection of this important memory cell subset.
24485168 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24485168 HIV-1 replication is restricted by SAMHD1 in monocyte-derived macrophage-like cells (PMA-treated U937 cells)
24445253 SAMHD1 is required for genome integrity by maintaining balanced dNTP pools. dNTP imbalances due to SAMHD1 deficiency cause DNA damage, leading to intrinsic activation of IFN signalling.
24402277 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24352659 Here, we report that SAMHD1 regulation of the dNTP concentrations influences HIV-1 template switching efficiency, particularly in macrophages.
24352659 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24336198 the crystal structure of a ternary complex of Vpx with the human E3 ligase substrate adaptor DCAF1 and the carboxy-terminal region of human SAMHD1
24336198 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24335234 SAMHD1 may have a function in DNA repair and the presence of SAMHD1 mutations in chronic lymphocytic leukemia promotes leukemia development.
24317272 analysis of the different activities of SAMHD1 splice variants in regulating drug sensitivity implied that the exon4 insertion might act as an indicator of the occurrence of liver cancer.
24246762 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24219908 These results suggested that SAMHD1 oligomerization is not required for the ability of the protein to block HIV-1 infection.
24217394 structural and functional analysis of tetrameric SAMHD1 deoxynucleoside triphosphate triphosphohydrolase
24173216 The ability of SIV Vpx to restrict SAMHD1 among different primate species is a manifestation of the SAMHD1 evolutionary pattern among those species
24141705 Binding of dGTP to four allosteric sites promotes tetramerization and induces a conformational change in the substrate-binding pocket to yield the catalytically active enzyme.
24139400 This study provides a mechanistic explanation for abortive HTLV-1 infection of monocytes and reports a link between SAMHD1 restriction, HTLV-1 reverse transcription intermediate sensing by STING, and initiation of IRF3-Bax driven apoptosis.
24088354 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
24067963 SAMHD1 inhibits replication of herpes simplex virus 1 in nondividing macrophages.
24035396 SAMHD1 inhibits ORF2p-mediated LINE-1 reverse transcription in isolated LINE-1 ribonucleoproteins by reducing ORF2p level. Thus, SAMHD1 may be a cellular regulator of LINE-1 activity that is conserved in mammals.
24026671 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
23986575 These findings support deoxynucleoside triphosphate pool depletion as the primary mechanism of SAMHD1 restriction of HIV-1 and argue against a nucleolytic mechanism, which would not be reversible.
23966382 These results indicate that SAMHD1 phosphorylation may be a negative regulator of SAMHD1 restriction activity.
23884314 SAMHD1 mRNA levels aresignificantly downregulated in leukocytes from Sezary syndrome patients.
23880768 SAMHD1 has the ability to hydrolyze base-modified nucleotides, indicating that the active site of SAMHD1 is not restrictive to such modifications
23874389 Multiple regions in SAMHD1 are critical for Vpx-mediated nuclear degradation.
23874202 Data suggest that, in an evolutionary model of virus-host interactions, binding between Vpx/Vpr and SAMHD1 (and subsequent degradation of SAMHD1) exhibits dynamic requirements that have toggled back and forth.
23874202 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
23872947 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
23858451 Synthesis by the reductase peaks during S-phase, and catabolism by SAMHD1 is maximal during G1 phase when large dNTP pools would prevent cells from preparing for a new round of DNA replication
23825958 SAMHD1 is a potential innate anti-viral player that suppresses the replication of a wide range of DNA viruses, as well as retroviruses, which infect non-dividing myeloid cells.
23825473 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
23744077 Data indicate that SAMHD1 controls HIV-1 sensitivity to nucleoside reverse transcriptase inhibitors (NRTIs).
23744077 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
23677995 direct down-modulation of Vpx catalytic activity, mediated by the same binding event that leads to SAMHD1 recruitment to the E3 ubiquitin ligase for proteasome-dependent degradation
23602554 The phosphorylation of SAMHD1 at Thr592 by cyclin A2/CDK1 is a key regulatory mechanism of its antiviral activity.
23601106 SAMHD1 phosphorylated on residue T592 is unable to block retroviral infection.
23526823 SAMHD1 overexpression induced by IL-12/IL-18 was not dependent on IFN-gamma.
23497283 Effective immune control of viral replication in HIV-2-infected individuals is not associated with increased Vpx-mediated degradation of SAMHD1.
23497255 The results suggest that SAMHD1 has broad anti-retroviral activity against which most viruses have not found an escape.
23426366 SAMHD1 tetramers are the biologically active form of this dNTPase and provide new insights into the functional organization of SAMHD1.
23426363 Promoter methylation regulates SAMHD1 gene expression in human CD4+ T cells
23371319 Mutations associated with Aicardi-Goutieres syndrome exhibit both impaired nucleic acid-binding and complex formation implicating interaction with nucleic acids as an integral aspect of SAMHD1 function.
23364794 The nuclease activity of SAMHD1 could represent an additional mechanism contributing to HIV-1 restriction and suppression of the autoimmune response through direct cleavage of viral and endogenous nucleic acids.
23269793 SAMHD1, by controlling the sensitivity of monocyte-derived dendritic cells to HIV-1 infection during intercellular contacts, impacts their ability to sense the virus and to trigger an innate immune response.
23231760 SAMHD1-mediated reduction of the intracellular dNTP pool in DCs is a common mechanism of HIV-1 restriction in myeloid cells. Endogenous expression of SAMHD1 in primary DCs or CD4+ T-lymphocytes is not upregulated by type I IFNs.
23158101 results showed that SAMHD1 blocks infection of HIV-2, feline immunodeficiency virus (FIV), bovine immunodeficiency virus (BIV), Equine infectious anemia virus (EIAV), N-tropic murine leukemia virus (N-MLV), and B-tropic murine leukemia virus (B-MLV)
23092512 Here, authors identified two naturally occurring splice variants lacking exons 8-9 and 14, respectively.
23092122 Here, authors identified SAMHD1 as the restriction factor preventing efficient HIV-1 viral DNA synthesis in non-cycling resting CD4+ T-cells.
23076149 there are several Vpx residues required for SAMHD1 degradation
23043103 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
23043100 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
22999946 Studies indicate that restriction factors APOBEC3G, TRIM5, Tetherin and SAMHD1 exhibit direct antiviral activity.
22978176 anti-HIV activity of SAMHD1
22973040 SAMHD1 is targeted by HIV-2 Vpx for ubiquitination and degradation in the nucleus.
22972397 SAMHD1 imposes an effective restriction to HIV-1 infection in the large pool of noncycling CD4(+) T cells in vivo.
22926205 In this Progress article, we describe how SAMHD1 regulates the pool of intracellular nucleotides to control HIV replication and the innate immune response.
22908011 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
22691373 Cytoplasmic variants of SAMHD1 potently block lentiviral infection and are resistant to Vpx-mediated degradation.
22589553 Vpx degradation of SAMHD1 is sufficiently rapid to enable appropriate progression of reverse transcription in monocyte-derived macrophages
22530776 Polymorphisms of SAMHD1 are unlikely to contribute to the infection and natural control of HIV-1 in European and African-American individuals.
22461318 Data suggest that SAMHD1 has a role in the nucleus that, if disrupted by mutation, leads to cytosolic accumulation of SAMHD1 and autoimmune disease.
22421880 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
22327569 Vpx prevented the SAMHD1-mediated decrease in dNTP concentration and induced the degradation of human and rhesus macaque SAMHD1 but had no effect on mouse SAMHD1
22327569 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
22174685 we propose that SAMHD1 protects primary CD14+ monocytes from HIV-1 infection
22069334 Vpx targets SAMHD1 for degradation in a viral strategy to control cellular deoxynucleotide levels for efficient replication
22056990 human SAMHD1 is a potent dGTP-stimulated triphosphohydrolase that converts deoxynucleoside triphosphates to the constituent deoxynucleoside and inorganic triphosphate
21740548 SAMHD1 functions as a myeloid-cell-specific HIV-1 restriction factor by inhibiting viral DNA synthesis.[Review]
21720370 Vpx relieves the inhibition of lentivirus infection in macrophages by loading SAMHD1 onto the CRL4(DCAF1) E3 ubiquitin ligase, leading to highly efficient proteasome-dependent degradation of the protein
21720370 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
21720361 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
21701517 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
21633013 conclude that intracerebral large artery disease is a common phenomenon in patients with SAMHD1 mutations
21613998 Vpx induces proteasomal degradation of SAMHD1
21613998 HIV-1-exposed monocyte-derived dendritic cells induce weak secretion of IFN-gamma and low amounts of intracellular Gag expression in the presence of SAMHD1
21402907 The inflammatory vasculopathies of the brain found in the patients with SAMHD1 mutation indicate its important roles in immunoregulation and cerebral vascular hemeostasis.
21204240 Autosomal dominant inheritance of a heterozygous mutation in SAMHD1 causing familial chilblain lupus.
21102625 A homozygous deletion of the SAMHD1 gene caused atypical Aicardi-Goutieres syndrome, presenting in utero with white matter destruction and associated with multiple mtDNA deletions.
20842748 report on four adult siblings with c.490C>T (p.Arg164X) mutation in SAMHD1, a gene most recently described in Aicardi-Goutieres syndrome, on both alleles in all affected siblings
20358604 Arthropathy with progressive contractures should now be considered part of the spectrum of Aicardi-Goutieres syndrome because of SAMHD1 mutations.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20156774 I510T mutation of p63 was detected in both RHS and AEC syndrome patients and mutation of S541 residue can lead to either RHS (S541Y) or AEC syndrome (S541F).
19525956 Study describes mutations in SAMHD1 as the cause of Aicardi-Goutieres syndrome (AGS) at the AGS5 locus and present data to show that SAMHD1 may act as a negative regulator of the cell-intrinsic antiviral response.
18546154 SAMHD1 mediates TNF-alpha stimulation of lung fibroblasts.

AA Sequence

MQRADSEQPSKRPRCDDSPRTPSNTPSAEADWSPGLELHPDYKTWGPEQVCSFLRRGGFEEPVLLKNIRE      1 - 70
NEITGALLPCLDESRFENLGVSSLGERKKLLSYIQRLVQIHVDTMKVINDPIHGHIELHPLLVRIIDTPQ     71 - 140
FQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVHALGEKQPELQISERDVLCVQIAGLCHDLGH    141 - 210
GPFSHMFDGRFIPLARPEVKWTHEQGSVMMFEHLINSNGIKPVMEQYGLIPEEDICFIKEQIVGPLESPV    211 - 280
EDSLWPYKGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFARVCEVDNELRIC    281 - 350
ARDKEVGNLYDMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYT    351 - 420
KLTDNIFLEILYSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLD    421 - 490
VKLKAEDFIVDVINMDYGMQEKNPIDHVSFYCKTAPNRAIRITKNQVSQLLPEKFAEQLIRVYCKKVDRK    491 - 560
SLYAARQYFVQWCADRNFTKPQDGDVIAPLITPQKKEWNDSTSVQNPTRLREASKSRVQLFKDDPM        561 - 626
//

Text Mined References (122)

PMID Year Title
26779819 2016 HD domain of SAMHD1 influences Vpx-induced degradation at a post-interaction step.
26733158 2016 Functional organization of human SAMHD1 and mechanisms of HIV-1 restriction.
26655245 2016 Low dNTP levels are necessary but may not be sufficient for lentiviral restriction by SAMHD1.
26606981 2015 Evidence that HIV-1 restriction factor SAMHD1 facilitates differentiation of myeloid THP-1 cells.
26504826 2015 SAMHD1 Gene Mutations Are Associated with Cerebral Large-Artery Atherosclerosis.
26431200 2015 Phospho-dependent Regulation of SAMHD1 Oligomerisation Couples Catalysis and Restriction.
26416562 2015 Regulation of deoxynucleotide metabolism in cancer: novel mechanisms and therapeutic implications.
26397446 2015 Interferon-stimulated gene factor 3 complex is required for the induction of sterile ? motif and HD domain-containing protein 1 expression by interferon-? in SMMC-7721 cells.
26342080 2015 The Deoxynucleoside Triphosphate Triphosphohydrolase Activity of SAMHD1 Protein Contributes to the Mitochondrial DNA Depletion Associated with Genetic Deficiency of Deoxyguanosine Kinase.
26294762 2015 Impaired dNTPase activity of SAMHD1 by phosphomimetic mutation of Thr-592.
26032178 2015 SAMHD1 specifically restricts retroviruses through its RNase activity.
25996507 2015 The Expression of Functional Vpx during Pathogenic SIVmac Infections of Rhesus Macaques Suppresses SAMHD1 in CD4+ Memory T Cells.
25936766 2015 Mutational analysis of HIV-2 Vpx shows that proline residue 109 in the poly-proline motif regulates degradation of SAMHD1.
25926647 2015 SAMHD1 Limits HIV-1 Antigen Presentation by Monocyte-Derived Dendritic Cells.
25890101 2015 Sterile alpha motif and histidine/aspartic acid domain-containing protein 1 (SAMHD1)-facilitated HIV restriction in astrocytes is regulated by miRNA-181a.
25825449 2015 SAMHD1 degradation enhances active suppression of dendritic cell maturation by HIV-1.
25760601 2015 The mechanism of substrate-controlled allosteric regulation of SAMHD1 activated by GTP.
25715102 2015 Low SAMHD1 expression following T-cell activation and proliferation renders CD4+ T cells susceptible to HIV-1.
25646359 2015 SAMHD1's protein expression profile in humans.
25532805 2015 Cyclin L2 is a critical HIV dependency factor in macrophages that controls SAMHD1 abundance.
25449277 2014 SAMHD1 is down regulated in lung cancer by methylation and inhibits tumor cell proliferation.
25423367 2015 The eukaryotic elongation factor eEF1A1 interacts with SAMHD1.
25392215 2015 Distinct characteristics of endometrial and decidual macrophages and regulation of their permissivity to HIV-1 infection by SAMHD1.
25288794 2014 Structural basis of allosteric activation of sterile ? motif and histidine-aspartate domain-containing protein 1 (SAMHD1) by nucleoside triphosphates.
25267621 2014 Structural basis of cellular dNTP regulation by SAMHD1.
25201733 2014 MicroRNA-181 expression regulates specific post-transcriptional level of SAMHD1 expression in vitro.
25063780 2014 Increased expression of SAMHD1 in a subset of HIV-1 elite controllers.
25038827 2014 The ribonuclease activity of SAMHD1 is required for HIV-1 restriction.
25019997 2014 Inhibition of Hepatitis B virus replication by SAMHD1.
25015816 2014 Cell cycle control and HIV-1 susceptibility are linked by CDK6-dependent CDK2 phosphorylation of SAMHD1 in myeloid and lymphoid cells.
25010268 2014 Effects of human SAMHD1 polymorphisms on HIV-1 susceptibility.
24828500 2014 Allosteric regulation of the human and mouse deoxyribonucleotide triphosphohydrolase sterile ?-motif/histidine-aspartate domain-containing protein 1 (SAMHD1).
24753578 2014 GTP activator and dNTP substrates of HIV-1 restriction factor SAMHD1 generate a long-lived activated state.
24712655 2014 Nuclear import of SAMHD1 is mediated by a classical karyopherin ?/?1 dependent pathway and confers sensitivity to VpxMAC induced ubiquitination and proteasomal degradation.
24623419 2014 Identification of cellular proteins interacting with the retroviral restriction factor SAMHD1.
24599229 2014 Moderate restriction of macrophage-tropic human immunodeficiency virus type 1 by SAMHD1 in monocyte-derived macrophages.
24574390 2014 Dendritic cell-lymphocyte cross talk downregulates host restriction factor SAMHD1 and stimulates HIV-1 replication in dendritic cells.
24554663 2014 CD4+ memory stem cells are infected by HIV-1 in a manner regulated in part by SAMHD1 expression.
24445253 2015 SAMHD1 prevents autoimmunity by maintaining genome stability.
24352659 2014 Host SAMHD1 protein promotes HIV-1 recombination in macrophages.
24336198 2014 Structural basis of lentiviral subversion of a cellular protein degradation pathway.
24335234 2014 SAMHD1 is mutated recurrently in chronic lymphocytic leukemia and is involved in response to DNA damage.
24317272 2014 Identification of natural splice variants of SAMHD1 in virus-infected HCC.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24219908 2013 Contribution of oligomerization to the anti-HIV-1 properties of SAMHD1.
24217394 2013 Structural insight into dGTP-dependent activation of tetrameric SAMHD1 deoxynucleoside triphosphate triphosphohydrolase.
24173216 2014 Variation of two primate lineage-specific residues in human SAMHD1 confers resistance to N terminus-targeted SIV Vpx proteins.
24141705 2013 Mechanism of allosteric activation of SAMHD1 by dGTP.
24139400 2013 Host restriction factor SAMHD1 limits human T cell leukemia virus type 1 infection of monocytes via STING-mediated apoptosis.
24067963 2013 SAMHD1 restricts herpes simplex virus 1 in macrophages by limiting DNA replication.
24035396 2013 Modulation of LINE-1 and Alu/SVA retrotransposition by Aicardi-Goutières syndrome-related SAMHD1.
23986575 2013 Inhibition of CUL4A Neddylation causes a reversible block to SAMHD1-mediated restriction of HIV-1.
23966382 2013 Restriction of virus infection but not catalytic dNTPase activity is regulated by phosphorylation of SAMHD1.
23884314 2014 Downregulation of SAMHD1 expression correlates with promoter DNA methylation in Sézary syndrome patients.
23880768 2013 GTP is the primary activator of the anti-HIV restriction factor SAMHD1.
23874389 2013 Identification of critical regions in human SAMHD1 required for nuclear localization and Vpx-mediated degradation.
23874202 2013 Evolutionary toggling of Vpx/Vpr specificity results in divergent recognition of the restriction factor SAMHD1.
23858451 2013 The deoxynucleotide triphosphohydrolase SAMHD1 is a major regulator of DNA precursor pools in mammalian cells.
23825958 2013 Host factor SAMHD1 restricts DNA viruses in non-dividing myeloid cells.
23744077 2013 Anti-HIV host factor SAMHD1 regulates viral sensitivity to nucleoside reverse transcriptase inhibitors via modulation of cellular deoxyribonucleoside triphosphate (dNTP) levels.
23677995 2013 HIV-2 and SIVmac accessory virulence factor Vpx down-regulates SAMHD1 enzyme catalysis prior to proteasome-dependent degradation.
23602554 2013 Phosphorylation of SAMHD1 by cyclin A2/CDK1 regulates its restriction activity toward HIV-1.
23601106 2013 The retroviral restriction ability of SAMHD1, but not its deoxynucleotide triphosphohydrolase activity, is regulated by phosphorylation.
23526823 2013 Restriction of HIV-1 replication in primary macrophages by IL-12 and IL-18 through the upregulation of SAMHD1.
23497283 2013 The efficiency of Vpx-mediated SAMHD1 antagonism does not correlate with the potency of viral control in HIV-2-infected individuals.
23497255 2013 Restriction of diverse retroviruses by SAMHD1.
23426366 2013 Tetramerization of SAMHD1 is required for biological activity and inhibition of HIV infection.
23426363 2013 Promoter methylation regulates SAMHD1 gene expression in human CD4+ T cells.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23371319 2013 Single-stranded nucleic acids promote SAMHD1 complex formation.
23364794 2013 Nuclease activity of the human SAMHD1 protein implicated in the Aicardi-Goutieres syndrome and HIV-1 restriction.
23269793 2013 SAMHD1 restricts HIV-1 cell-to-cell transmission and limits immune detection in monocyte-derived dendritic cells.
23231760 2012 SAMHD1 restricts HIV-1 infection in dendritic cells (DCs) by dNTP depletion, but its expression in DCs and primary CD4+ T-lymphocytes cannot be upregulated by interferons.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23158101 2013 Contribution of SAM and HD domains to retroviral restriction mediated by human SAMHD1.
23092512 2012 Identification and characterization of naturally occurring splice variants of SAMHD1.
23092122 2012 SAMHD1 restricts HIV-1 reverse transcription in quiescent CD4(+) T-cells.
23076149 2012 Functional analysis of the relationship between Vpx and the restriction factor SAMHD1.
22999946 2012 Intrinsic cellular defenses against human immunodeficiency viruses.
22978176 2012 [Research progress of the anti-HIV activity of SAMHD1].
22973040 2012 The Vpx lentiviral accessory protein targets SAMHD1 for degradation in the nucleus.
22972397 2012 SAMHD1 restricts HIV-1 infection in resting CD4(+) T cells.
22926205 2012 Restricting HIV the SAMHD1 way: through nucleotide starvation.
22691373 2012 Role of SAMHD1 nuclear localization in restriction of HIV-1 and SIVmac.
22589553 2012 Tight interplay among SAMHD1 protein level, cellular dNTP levels, and HIV-1 proviral DNA synthesis kinetics in human primary monocyte-derived macrophages.
22530776 2012 Polymorphisms of the SAMHD1 gene are not associated with the infection and natural control of HIV type 1 in Europeans and African-Americans.
22461318 2012 SAMHD1 is a nucleic-acid binding protein that is mislocalized due to aicardi-goutières syndrome-associated mutations.
22327569 2012 SAMHD1 restricts the replication of human immunodeficiency virus type 1 by depleting the intracellular pool of deoxynucleoside triphosphates.
22174685 2011 SAMHD1-deficient CD14+ cells from individuals with Aicardi-Goutières syndrome are highly susceptible to HIV-1 infection.
22069334 2011 Aicardi-Goutieres syndrome gene and HIV-1 restriction factor SAMHD1 is a dGTP-regulated deoxynucleotide triphosphohydrolase.
22056990 2011 HIV-1 restriction factor SAMHD1 is a deoxynucleoside triphosphate triphosphohydrolase.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21740548 2011 SAMHD1: a new insight into HIV-1 restriction in myeloid cells.
21720370 2011 Vpx relieves inhibition of HIV-1 infection of macrophages mediated by the SAMHD1 protein.
21633013 2011 Cerebral vasculopathy is a common feature in Aicardi-Goutieres syndrome associated with SAMHD1 mutations.
21613998 2011 SAMHD1 is the dendritic- and myeloid-cell-specific HIV-1 restriction factor counteracted by Vpx.
21402907 2011 Homozygous mutation in SAMHD1 gene causes cerebral vasculopathy and early onset stroke.
21269460 2011 Initial characterization of the human central proteome.
21204240 2011 Autosomal dominant inheritance of a heterozygous mutation in SAMHD1 causing familial chilblain lupus.
21102625 2011 A large homozygous deletion in the SAMHD1 gene causes atypical Aicardi-Goutiéres syndrome associated with mtDNA deletions.
20842748 2010 Cerebral arterial stenoses and stroke: novel features of Aicardi-Goutières syndrome caused by the Arg164X mutation in SAMHD1 are associated with altered cytokine expression.
20358604 2010 Familial Aicardi-Goutières syndrome due to SAMHD1 mutations is associated with chronic arthropathy and contractures.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20156774 AEC syndrome caused by heterozygous mutation in the SAM domain of p63 gene.
20131292 2010 Expanding the phenotypic spectrum of lupus erythematosus in Aicardi-Goutières syndrome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19525956 2009 Mutations involved in Aicardi-Goutières syndrome implicate SAMHD1 as regulator of the innate immune response.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18546154 2008 Dendritic cell-derived interferon-gamma-induced protein mediates tumor necrosis factor-alpha stimulation of human lung fibroblasts.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11064105 2000 Identification of human homologue of mouse IFN-gamma induced protein from human dendritic cells.