Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
acute myeloid leukemia 783 3.3e-02
Disease Target Count Z-score Confidence
Metabolic syndrome X 52 0.0 1.2

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia -1.800 3.3e-02

 Compartment GO Term (1)

AA Sequence

MANSLLEGVFAEVKEPCSLPMLSVDMENKENGSVGVKNSMENGRPPDPADWAVMDVVNYFRTVGFEEQAS      1 - 70
AFQEQEIDGKSLLLMTRNDVLTGLQLKLGPALKIYEYHVKPLQTKHLKNNSS                       71 - 122
//

Text Mined References (4)

PMID Year Title