Property Summary

NCBI Gene PubMed Count 39
PubMed Score 1474.25
PubTator Score 381.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.800 3.9e-02

Gene RIF (18)

PMID Text
25216516 NEDD4-1 overexpression sensitizes cancer cells to etoposide-induced apoptosis by reducing SAG levels through targeted degradation. SAG is added to a growing list of NEDD4-1 substrates and mediates its biological function.
24430184 Sag is a Kras-cooperating oncogene that promotes lung tumorigenesis
23277586 Based on their observed affinity for arrestin-1, P-opsin and inactive P-Rh very likely affect the physiological monomer-dimer-tetramer equilibrium of arrestin-1, and should therefore be taken into account when modeling photoreceptor function.
22419846 Compound heterozygosity of a nonsense R193X mutation and a heterozygous deletion of 3,224 bp encompassing exon 2 in the SAG gene is the cause of Oguchi's disease in a Chinese family.
21987685 We describe a case of Oguchi disease with unusual findings caused by a putative heterozygous mutation in the SAG gene.
21922265 the arrestin 1147delA, which has been known as a frequent cause of Oguchi disease, also may be related to the pathogenesis of autosomal recessive RP.
21904838 Identification of autoantibodies specific for two retinal antigens (CRALBP and S-Ag) supports the concept of an autoimmunological origin of the disease.
21447990 Macular dysfunction can occur in Oguchi disease with the 1147delA mutation in the SAG gene.
21288033 maintenance of low levels of the active monomer is the biological role of arrestin-1 self-association
20801516 Observational study of genetic testing. (HuGE Navigator)
18685727 S-Ag specific T cells are present in certain active Behcet's disease patients, and most of them are activated memory CD4(+) T cells.
18413662 ARRESTIN binds to different phosphorylated regions of the thyrotropin-releasing hormone receptor with distinct functional consequences.
18175313 two models of interaction for the human S-arrestin/rhodopsin complex
17332750 The tetramer form of arrestin increases the arrestin-binding capacity of microtubules while readily dissociating to supply active monomer when it is needed to quench rhodopsin signaling.
15713799 studies suggest that IRBP and S-Ag can initiate innate and, in sensitive individuals, adaptive immune response by attracting iDCs and T and B cells expressing CXCR3 and CXCR5
15295660 Mutation 926delA of the SAG gene is the main cause of Oguchi disease in Japanese. This mutation appears to have been inherited from a single founder.
15234147 The existence of 2 novel mutations of the arrestin gene in 2 unrelated Japanese patients strongly supports the previous data that arrestin gene mutations are associated with Oguchi's disease
15232620 Rhodopsin-arrestin complexes alter the morphology of endosomal compartments and severely damage receptor-mediated endocytic functions in retinitis pigmentosa.

AA Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFR      1 - 70
YGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAP     71 - 140
QDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLA    141 - 210
VSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTK    211 - 280
TLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSE    281 - 350
VATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE                   351 - 405
//

Text Mined References (39)

PMID Year Title
25216516 2014 SAG/RBX2 is a novel substrate of NEDD4-1 E3 ubiquitin ligase and mediates NEDD4-1 induced chemosensitization.
24430184 2014 Inactivation of SAG/RBX2 E3 ubiquitin ligase suppresses KrasG12D-driven lung tumorigenesis.
23277586 2013 Involvement of distinct arrestin-1 elements in binding to different functional forms of rhodopsin.
22419846 2012 A Chinese family with Oguchi's disease due to compound heterozygosity including a novel deletion in the arrestin gene.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21987685 2011 Oguchi disease with unusual findings associated with a heterozygous mutation in the SAG gene.
21922265 2011 Oguchi disease masked by retinitis pigmentosa.
21904838 2011 [Blind spot enlargement syndrome in acute zonal occult outer retinopathy with detection of autoantibodies against the retinal antigens CRALBP and S-Ag].
21447990 2011 Macular Dysfunction in Oguchi Disease with the Frequent Mutation 1147delA in the SAG Gene.
21288033 2011 Robust self-association is a common feature of mammalian visual arrestin-1.
20801516 2011 Simultaneous mutation detection in 90 retinal disease genes in multiple patients using a custom-designed 300-kb retinal resequencing chip.
20705733 2010 Common variants in the calcium-sensing receptor gene are associated with total serum calcium levels.
18685727 2008 S-antigen specific T helper type 1 response is present in Behcet's disease.
18413662 2008 Arrestin binds to different phosphorylated regions of the thyrotropin-releasing hormone receptor with distinct functional consequences.
18175313 2008 In silico study of the human rhodopsin and meta rhodopsin II/S-arrestin complexes: impact of single point mutations related to retina degenerative diseases.
17332750 2007 Structure and function of the visual arrestin oligomer.
17286855 2007 Mapping of transcription start sites of human retina expressed genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15713799 2005 Autoantigens signal through chemokine receptors: uveitis antigens induce CXCR3- and CXCR5-expressing lymphocytes and immature dendritic cells to migrate.
15295660 Gene analysis and evaluation of the single founder effect in Japanese patients with Oguchi disease.
15234147 2004 Novel mutations in the arrestin gene and associated clinical features in Japanese patients with Oguchi's disease.
15232620 2004 Structural and functional impairment of endocytic pathways by retinitis pigmentosa mutant rhodopsin-arrestin complexes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
10952973 2000 Acidic amino acids flanking phosphorylation sites in the M2 muscarinic receptor regulate receptor phosphorylation, internalization, and interaction with arrestins.
9565049 1998 Arrestin gene mutations in autosomal recessive retinitis pigmentosa.
9501883 1998 Evaluation of the human arrestin gene in patients with retinitis pigmentosa and stationary night blindness.
9020843 1997 Defects in the rhodopsin kinase gene in the Oguchi form of stationary night blindness.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8617782 1996 Effect of different G protein-coupled receptor kinases on phosphorylation and desensitization of the alpha1B-adrenergic receptor.
7695743 1994 Chromosome mapping of the human arrestin (SAG), beta-arrestin 2 (ARRB2), and beta-adrenergic receptor kinase 2 (ADRBK2) genes.
7670478 1995 A homozygous 1-base pair deletion in the arrestin gene is a frequent cause of Oguchi disease in Japanese.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.
3164688 1988 The sequence of human retinal S-antigen reveals similarities with alpha-transducin.
2550422 1989 Regulation of rhodopsin dephosphorylation by arrestin.
2249983 1990 Structural organization of the human S-antigen gene. cDNA, amino acid, intron, exon, promoter, in vitro transcription, retina, and pineal gland.
1917988 1991 Phosphorylated rhodopsin and heparin induce similar conformational changes in arrestin.
1533347 1992 Immunocytochemical demonstration of rod-opsin, S-antigen, and neuron-specific proteins in the human pineal gland.
1325454 1992 Activation of bovine rod outer segment phospholipase C by arrestin.