Property Summary

NCBI Gene PubMed Count 31
PubMed Score 26.87
PubTator Score 22.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis -1.300 1.6e-02
astrocytic glioma -1.600 3.1e-02
osteosarcoma 2.365 3.4e-06
medulloblastoma 1.100 1.1e-02
adrenocortical carcinoma 1.160 2.2e-02
lung cancer 1.900 5.4e-04
atypical teratoid/rhabdoid tumor 1.300 8.2e-03
ovarian cancer 2.000 2.2e-05

 GWAS Trait (1)

Gene RIF (8)

PMID Text
26403403 the expression of SENP8, SAE1, PIAS1, PIAS2 and ZMIZ1 is deregulated in the majority of PTC tissues, likely contributing to the PTC phenotype.
25842831 as it has been shown by flow cytometry analysis, specific knockdown of SAE1 slowed down the cell population at G0/G1 phase and induced apoptosis of RKO cells.
22884621 Data indicate the role of anti-SUMO activating enzyme SAE1 and SAE2 antibody as marker of dermatomyositis.
22403398 Data show that the SAE2 subunit of the small ubiquitin-like modifier (SUMO) E1 is autoSUMOylated at residue Lys-236, and SUMOylation was catalyzed by Ubc9 at several additional Lys residues surrounding the catalytic Cys-173 of SAE2.
22157079 loss of SAE1/2 activity drives synthetic lethality with Myc; inactivation of SAE2 leads to mitotic catastrophe and cell death upon Myc hyperactivation; findings in Myc-high breast cancers suggest low tumor SAE1 and SAE2 correlates metastasis-free survival
21209321 The mammalian E1 subunits can be imported separately, identify nuclear localization signals (NLSs) in Aos1 and in Uba2, and demonstrate that their import is mediated by importin alpha/beta in vitro and in intact cells.
16421094 SUMO-1 controls the protein stability and the biological function of phosducin.
15660128 structures of heterodimeric Sae1/Sae2-Mg.ATP and Sae1/Sae2-SUMO-1-Mg.ATP complexes

AA Sequence

MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ      1 - 70
VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV     71 - 140
KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK    141 - 210
VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL    211 - 280
GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK        281 - 346
//

Text Mined References (37)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26403403 PAPILLARY THYROID CANCER IS CHARACTERIZED BY ALTERED EXPRESSION OF GENES INVOLVED IN THE SUMOYLATION PROCESS.
25842831 [Lentivirus-mediated siRNA targeting sae1 induces cell cycle arrest and apop- tosis in colon cancer cell RKO].
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22884621 2012 Anti-SAE antibodies in autoimmune myositis: identification by unlabelled protein immunoprecipitation in an Italian patient cohort.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22403398 2012 Small ubiquitin-like modifier (SUMO) modification of E1 Cys domain inhibits E1 Cys domain enzymatic activity.
22157079 2012 A SUMOylation-dependent transcriptional subprogram is required for Myc-driven tumorigenesis.
21968017 2011 Ribosomal protein S3 is stabilized by sumoylation.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21269460 2011 Initial characterization of the human central proteome.
21209321 2011 Importin ?/? mediates nuclear import of individual SUMO E1 subunits and of the holo-enzyme.
20164921 2010 Active site remodelling accompanies thioester bond formation in the SUMO E1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16791210 2006 Dynamic proteomics in individual human cells uncovers widespread cell-cycle dependence of nuclear proteins.
16620772 2006 A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers.
16421094 2006 SUMO-1 controls the protein stability and the biological function of phosducin.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15660128 2005 Structures of the SUMO E1 provide mechanistic insights into SUMO activation and E2 recruitment to E1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12941704 2003 Endonucleolytic processing of CCA-less tRNA precursors by RNase Z in Bacillus subtilis.
12924945 2003 Role of an N-terminal site of Ubc9 in SUMO-1, -2, and -3 binding and conjugation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11481243 2001 Expression and regulation of the mammalian SUMO-1 E1 enzyme.
11451954 2001 Polymeric chains of SUMO-2 and SUMO-3 are conjugated to protein substrates by SAE1/SAE2 and Ubc9.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10217437 1999 Molecular cloning and characterization of human AOS1 and UBA2, components of the sentrin-activating enzyme complex.
10187858 1999 Identification of the enzyme required for activation of the small ubiquitin-like protein SUMO-1.
9920803 1999 In vitro SUMO-1 modification requires two enzymatic steps, E1 and E2.