Property Summary

NCBI Gene PubMed Count 9
PubMed Score 5.91
PubTator Score 2.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Melanoma 261
Disease Target Count Z-score Confidence
Colon adenoma 5 3.881 1.9

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 5.6e-03
malignant mesothelioma 1.200 2.6e-06
astrocytoma 1.100 1.3e-02
tuberculosis 1.400 1.1e-03
non-small cell lung cancer 1.252 2.9e-18
lung cancer 1.600 3.7e-05
Breast cancer 3.800 3.4e-02
pancreatic carcinoma 1.100 5.6e-03
lung adenocarcinoma 1.500 1.3e-11
ovarian cancer 3.400 5.8e-08
facioscapulohumeral dystrophy 1.300 6.5e-03

Gene RIF (1)

PMID Text
18838617 SHD1 is a novel cytokine-inducible negative feedback regulator of STAT5a.

AA Sequence

MAGRRAQTGSAPPRPAAPHPRPASRAFPQHCRPRDAERPPSPRSPLMPGCELPVGTCPDMCPAAERAQRE      1 - 70
REHRLHRLEVVPGCRQDPPRADPQRAVKEYSRPAAGKPRPPPSQLRPPSVLLATVRYLAGEVAESADIAR     71 - 140
AEVASFVADRLRAVLLDLALQGAGDAEAAVVLEAALATLLTVVARLGPDAARGPADPVLLQAQVQEGFGS    141 - 210
LRRCYARGAGPHPRQPAFQGLFLLYNLGSVEALHEVLQLPAALRACPPLRKALAVDAAFREGNAARLFRL    211 - 280
LQTLPYLPSCAVQCHVGHARREALARFARAFSTPKGQTLPLGFMVNLLALDGLREARDLCQAHGLPLDGE    281 - 350
ERVVFLRGRYVEEGLPPASTCKVLVESKLRGRTLEEVVMAEEEDEGTDRPGSPA                    351 - 404
//

Text Mined References (16)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18838617 2009 SHD1 is a novel cytokine-inducible, negative feedback regulator of STAT5-dependent transcription.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16239144 2005 Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15322101 2004 The Sac3 homologue shd1 is involved in mitotic progression in mammalian cells.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.