Property Summary

NCBI Gene PubMed Count 3
PubMed Score 2.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma 1.200 9.6e-05
atypical teratoid / rhabdoid tumor 1.600 3.7e-11
glioblastoma 1.500 7.8e-10
group 3 medulloblastoma 2.000 2.1e-05
lung carcinoma 1.300 2.8e-32
medulloblastoma, large-cell 2.300 5.3e-07
pituitary cancer 1.100 5.4e-05
primitive neuroectodermal tumor 1.700 3.9e-06

Gene RIF (2)

AA Sequence

MDRNPSPPPPGRDKEEEEEVAGGDCIGSTVYSKHWLFGVLSGLIQIVSPENTKSSSDDEEQLTELDEEME      1 - 70
NEICRVWDMSMDEDVALFLQEFNAPDIFMGVLAKSKCPRLREICVGILGNMACFQEICVSISSDKNLGQV     71 - 140
LLHCLYDSDPPTLLETSRLLLTCLSQAEVASVWVERIQEHPAIYDSICFIMSSSTNVDLLVKVGEVVDKL    141 - 210
FDLDEKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWLDVYMHILQLLTTVDDG    211 - 280
IQAIVHCPDTGKDIWNLLFDLVCHEFCQSDDPPIILQEQKTVLASVFSVLSAIYASQTEQEYLKIEKVDL    281 - 350
PLIDSLIRVLQNMEQCQKKPENSAESNTEETKRTDLTQDDFHLKILKDILCEFLSNIFQALTKETVAQGV    351 - 420
KEGQLSKQKCSSAFQNLLPFYSPVVEDFIKILREVDKALADDLEKNFPSLKVQT                    421 - 474
//

Text Mined References (9)

PMID Year Title