Property Summary

NCBI Gene PubMed Count 216
PubMed Score 1196.55
PubTator Score 406.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.900 8.6e-23

Protein-protein Interaction (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
488769 other 2 / 0 / 0 Center Based Initiative to identify novel inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): fluorescence-based cell-based quantitative PCR assay to identify inhibitors of LRH-1 target gene expression

Gene RIF (174)

PMID Text
26945629 Structure, function and SAA1 gene polymorphisms
26937641 Serum Amyloid A induces inflammation, proliferation and cell death in activated hepatic stellate cells.
26750935 Amyloid A overexpressed in renal cell carcinoma patients and can serve as a prognostic marker.
26642365 incorporation of SAA into HDL preparations reduced antiinflammatory properties but not to the same extent as HDL from AgNO3-injected mice
26300108 The SAA1 rs12218 polymorphism was significantly more prevalent in ankylosing spondylitis patients with amyloidosis.
26297794 Serum amyloid A1alpha induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26135899 Autocrine/paracrine and recombinant human SAA1 via TLR4 stimulate a proinflammatory phenotype that is both part of the early phase of osteogenic differentiation and the development of senescence.
26130702 These functional properties set SAA apart from well-characterized inflammatory factors, such as LPS and TNF-alpha, suggesting that it may play a homeostatic role during the course of inflammation.
26052716 human SAA is possibly only expressed in a subset of septic patients; SAA induces HMGB1 release via TLR4 and RAGE receptors; SAA supplementation worsens the outcome of lethal endotoxemia
26037829 HDL3 subpopulations in ST segment elevation myocardial infarction were enriched 10 times in SAA patients.
25963492 Our results showed PCT as a valuable marker of bacterial infections in febrile patients. PCT was superior to CRP, IL-6 or SAA in the early identification of bacterial infection
25932604 SR-B1 and p38 MAPK are involved in signaling pathway of serum amyloid A-induced angiogenesis in rheumatoid arthritis.
25736604 The detailed analysis of the docking results points to the fact that the best serum amyloid A-Cystatin C (SAA-hCC) binding is achieved by the peptides inclined toward interacting via Lys90 and Arg 96 (with ffhCC Ser98 and Tyr102, respectively).
25656165 Genetic polymorphisms in SAA1 are associated with coronary artery disease in the Han and Uygur populations in Western China.
25623898 potential marker for detecting the activity of srcoidosis
25607823 The relative abundance of the N-terminal arginine truncation of SAA1.1 is significantly decreased in diabetes and negatively correlates with measures of glycemic and lipid control.
25605163 High SAA serum level is associated with hepatocellular carcinoma.
25531567 Data suggest that serum amyloid A (SAA) is a candidate for diabetic kidney disease therapeutic and biomarker discovery.
25525305 SAA has a role in activity of rheumatoid arthritis and risk of cardiovascular and renal involvement
25394530 Mutations in genetic biomarker SAA1 gene related to amyloidosis processes may play a crucial role in chronic renal failure patients who require long-term hemodialysis.
25344970 during the first 24 hours from beginning of acute pancreatitis, SAA achieved its best prognostic value.
25240611 Although SAA concentrations were elevated in the sera, there was no significant difference in these concentrations between familial Mediterranean fever patients and rheumatoid arthritis patients.
25231464 keratinocyte-derived SAA triggers a key inflammatory mediator, IL-1beta, via NLRP3 inflammasome activation, providing new potential targets for the treatment of this chronic skin disease.
25073702 Serum amyloid A is a retinol binding protein that transports retinol during bacterial infection.
24884805 SAA1 gene expression in COPD patients is responsible for the secretion of this molecule in different cell types.
24854450 we concluded that genetic polymorphisms of SAA1 may be a genetic marker of MI in the Chinese population
24846290 the innate neutrophil immune response against SAA involves a two-step activation process: an initial signal promoting expression of pro-IL-1beta and a second signal involving Syk-dependent activation of the NLRP3 inflammasome and caspase-1.
24751653 The aim of this study was to investigate the effects of adipose tissue-derived human SAA on atherosclerosis in ApoE-/- mice.
24732911 Zn deficiency enhances the acute phase response and particularly the JAK-STAT3 pathway, resulting in increased serum amyloid A production.
24706838 combined structural and functional studies provide mechanistic insights into the pathogenic contribution of glycosaminoglycan in SAA1.1-mediated AA amyloid formation
24632292 these results point to a novel mechanism, by which SAA initiates a monocyte-dependent process that drives mitogenic signals in Treg.
24608426 homozygous SAA1.5/1.5 genotype appears to be a recessive susceptibility gene, which has lost the antiangiogenic function, whereas SAA1.1 and SAA1.3 are the dominant alleles of the tumor suppressor phenotype.
24469032 serum amyloid A1 and A3 induce metastasis, and are targets of metastasis-inducing S100A4.
24454983 Differential proteomic analysis allowed for identifying increased levels of acute-phase serum amyloid A protein (AP SAA) in all lipoprotein fractions.
24440699 Examined the effect of amino acid variations in SAA1 isoforms on the amyloidogenic properties. All SAA1 isoforms adopted alpha-helix structures at 4 degrees C, but were unstructured at 37 degrees C.
24228251 From the findings of experimental studies, PON1 appears to be cooperatively regulated by inflammation- and oxidative stress-related molecules linked with SAA regulation in humans
24209691 SAA was higher in metabolic syndrome patients than controls. The inverse relationship between SAA and bilirubin found in controls was absent in MetS patients, which could be attributable to MetS-associated abnormalities in HDL characteristics.
24171731 Obese children showed increased frequency of SAA1 rs12218 and rs4638289 polymorphisms as compared to healthy children.
24096654 CGRP promotes SAA synthesis through activation of IL-6 in human hepatocytes
24061501 Increased serum levels of SAA, phospholipase A2 group IIA , and C reactive protein were observed in patients with benign prostate hyperplasia, localized and metastasized prostate cancer in comparison to healthy individuals.
24030940 Data suggest that SAA is expressed in developing ovarian follicles and in corpora lutea; high levels of SAA in follicular fluid are associated with reduced pregnancy rate in women undergoing ovarian stimulation for in vitro fertilization.
23994331 SAA is independently and inversely related to apoA-I but not to HDL-cholesterol in patients with angina pectoris.
23987125 Genetic polymorphism of SAA1 may be a genetic marker of cerebral infarction in Chinese.
23967285 we find no evidence that adipose tissue-derived hSAA1 influences the development of insulin resistance or obesity-related inflammation.
23940069 The genetic polymorphisms of SAA1 were associated with plasma glucose levels in non-diabetic subjects
23898911 Our results indicated that the rs12218 in the SAA1gene was associated with lipid levels in a Chinese population
23867815 HIV-1 gp120-treated vaginal epithelial cells show upregulation of serum amyloid A1 (SAA1) expression as compared to untreated control
23836469 All amino acid residues in the SAA sequence, essential for the formation of the protein complex with cystatin C, are basic ones.
23776697 Systemic or local A-SAA expression inside OA joint cavity may play a key role in inflammatory process seen in osteoarthritis, which could be counteracted by TLR4 inhibition.
23750222 the amyloid formation pathway of SAA
23623642 SAA up-regulates Lp-PLA2 production significantly via a FPRL1/MAPKs./PPAR-gamma signaling pathway.
23597931 The CSF biomarker amyloid 1-42 is important and useful as part of the diagnostic procedure for detecting AD and other dementia in elderly patients displaying psychotic symptoms.
23566403 SAA levels can be associated with clinical phenotypes in multiple sclerosis and neuromyelitis optica.
23522429 The present results indicate that both osteoporosis and lipids levels are associated with the TT genotype of rs12218 in the human SAA1 gene.
23454129 SAA stimulates foam cell formation via LOX1 induction, and thus likely contributes to atherogenesis.
23437051 SAA1 gene polymorphisms, consisting of -13T/C single nucleotide polymorphism (SNP) in the 5'-flanking region and SNPs within exon 3 are associated with susceptibility to Familial Mediterranean Fever in the Japanese population.
23391827 a novel STAT3 non-consensus TFBS at nt -75/-66 downstream of the NF-kappaB RE in the SAA1 promoter region that is required for NF-kappaB p65 and STAT3 to activate SAA1 transcription
23357645 variant p.Gly90Asp SAA1 protein eliciting significantly reduced inflammatory responses in macrophages through a reduction in the secretion of inflammatory cytokines.
23300020 High serum SAA level is associated with obesity and estrogen receptor-negative breast tumors.
23255027 Letter: serum amyloid A levels are elevated in venous thromboembolism.
23238662 Findings indicate similarly strong prospective associations with type 2 diabetes for A-SAA and hs-CRP and suggest a potential causal link via postchallenge hyperglycemia.
23230824 in acute phase of epilepsy, the serum SAA increased, but after 3 months of treatment, the SAA peak was disappeared.
23223242 Pathogenic serum amyloid A 1.1 shows a long oligomer-rich fibrillation lag phase contrary to the highly amyloidogenic non-pathogenic SAA2.2
23171281 Renal AA-amyloidosis is the predominant cause of renal failure in intravenous drug users. Patients with AA-amyloidosis are more likely to be HIV infected and tend to have a higher rate of repeated systemic infections.
23165195 Lipid-poor SAA, but not high density lipoprotein-associated SAA, stimulates G-CSF production.
22901189 High serum amyloid A expression is associated with benign neoplasm of pancreas.
22827403 Data suggest that serum amyloid protein A (SAA1) level in gestational diabetes is predictive of subclinical atherosclerosis in these women; SAA1 levels correlate with risk factors and may serve as biomarker of future atherosclerotic heart disease.
22771314 SAA levels measured by ELISA in 97 NSCLC patients treated with gefitinib correlated with the clinical outcome of the patients
22768267 The rs12218 single nucleotide polymorphism in the SAA1 gene was associated with SUA levels in Chinese subjects, indicating that carriers of the T allele of rs12218 have a high risk of hyperuricemia.
22766792 Serum amyloid A-positive hepatocellular neoplasms may be a new type of inflammatory hepatocellular tumors in alcoholic patients.
22552174 In patients with persistent Atrial Fibrillation and preserved LVEF, serum amyloid a and CRP levels are independent predictors of AF subacute recurrence rate.
22447522 Serum amyloid A (SAA) induces pentraxin 3 (PTX3) production in rheumatoid synoviocytes.
22371903 Amyloid A (AA) proteins in biopsy samples taken from the stomachs of patients with AA amyloidosis
22367597 findings suggested that SAA was significantly associated with disease duration and gastrointestinal manifestations manifestations in Henoch-Schonlein purpura patients
22341353 Purified ten targeted proteins from sera of patients with various types of advanced stage(stage III-IV)cancers. These proteins were identified as isoforms of the human serum amyloid protein A (SAA) family with or without truncations at their N-terminals.
22300576 Large-scale isotype-specific quantification of Serum amyloid A 1/2 by multiple reaction monitoring in crude sera.
22076945 acute phase SAA may be involved in joint destruction though MMP induction and collagen cleavage in vivo.
22011672 Reactive amyloid A (AA) amyloidosis, one of the most severe complications of RA, is a serious, potentially life-threatening disorder caused by deposition of AA amyloid fibrils in multiple organs.
21953030 report abundance levels of SAA in serum samples from patients with advanced breast cancer, colorectal cancer (CRC) and lung cancer compared to healthy controls (age and gender matched) using commercially available enzyme-linked immunosorbent assay kits
21876610 Serum amyloid alpha is increased in complicated parapneumonic effusion, and it might be useful as a biomarker for complicated and uncomplicated parapneumonic effusion.
21624307 The genetic polymorphism rs12218 of SAA1 might be a promoting factor for carotid intima media thickness in Han Chinese people.
21569756 the N-terminal region plays a crucial role as a rigid core and the central region facilitates the elongation of fibrils in heparin-induced amyloidogenesis of SAA molecule
21465531 SAA up-regulates PTX3 production via FPRL1 significantly, and thus, contributes to the inflammatory pathogenesis of atherosclerosis.
21449704 CC genotype of rs12218 in the SAA1 gene was associated with decreased ABI in Chinese Han subjects, which indicated that the carriers of CC genotype of rs12218 have high risk of peripheral arterial disease.
21325601 A novel anti-inflammatory role of SAA in the induction of a micro-environment that supports T(reg) expansion at sites of infection or tissue injury, likely to curb (auto)-inflammatory responses.
21309051 Gestational diabetes is associated with loss of natural variation of C-reactive protein and serum amyloid A, suggesting altered modulation of inflammation.
21141971 Data suggest that a higher concentration of SAA can serve as an indicator of lung adenocarcinoma and represents a therapeutic target for the inhibition of lung cancer metastasis.
21124955 These findings demonstrate a key role of the 11p15.5-p13 region in the regulation of baseline A-SAA levels.
21103356 Data show that both rs12218 of the SAA1 gene and rs2468844 of SAA2 gene are associated with carotid IMT in healthy Han Chinese subjects.
21067563 Intestinal epithelial SAA displays bactericidal properties in vitro and could play a protective role in experimental mouse colitis.
20979827 In Chinese Han people, the genetic polymorphism of SAA1 may reflect the serum concentration of HDL-C.
20979827 Observational study of gene-disease association. (HuGE Navigator)
20964562 The blood levels of serum amyloid A protein and transthyretin were found to be significantly increased in lung cancer patients.
20877498 Serum amyloid A protein was significantly increased in vivax malaria patient's plasma.
20869715 acute-phase Serum Amyloid A has a role in response to metformin treatment in insulin resistant women with the polycystic ovary syndrome
20853849 This study data suggested that SAA activated PPARgamma through extracellular signal-regulated kinase 1/2 (ERK1/2)-dependent COX-2 expression.
20713982 the expression of SAA in human benign and malignant ovarian epithelial tumors
20677144 Observational study of genotype prevalence. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20502455 A differential protein with m/z 11.6 kDa was detected and identified as an isoform of human serum amyloid A (SAA). It was significantly increased by 1822% in lung cancer patients when compared with the healthy controls.
20463814 Induction of acute phase protein serum amyloid A (A-SAA) occurred as early as 5-7 days prior to the first detection of plasma viral HIV-1 RNA, considerably prior to any elevation in systemic cytokine levels
20435930 A-SAA promotes cell migrational mechanisms and angiogenesis critical to rehumatoid arthritis pathogenesis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20184536 The infectious group was subdivided into bacterial and viral infections, significantly higher leukocyte, serum amyloid A values were observed.
20177146 The results indicate that SAA stimulates FPR2-mediated activation of p38 MAPK and JNK, which are independent of a pertussis toxin-sensitive G-protein and are essential for SAA-induced CCL2 production.
20061576 Data indicate that SAA1 contributes to the reduced reverse cholesterol transport observed during acute phase responses
20022911 High SAA1 is associated with metastatic renal cell cancer.
19925664 Measuring the oxidation-reduction potential (ORP) of plasma in the critically injured, with injury severity and serum amyloid A (SAA) levels. Results suggest the presence of an oxidative environment in the plasma of critically injured as measured by ORP.
19922330 Results suggest that the relatively high affinity of SAA1.5 for high-density lipoprotein may cause the high serum concentration and may be related to the low susceptibility to amyloidosis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19850938 During atherogenesis, SAA can amplify the involvement of smooth muscle cells in vascular inflammation and that this can lead to deposition of sPLA(2) and subsequent local changes in lipid homeostasis.
19833744 Results describe a significant inverse correlation between serum amyloid A and IgG levels and anti-SSA antibody titers as well as a trend towards an inverse correlation between SAA and ANA and RF titers, but not between CRP and these autoantibodies.
19758820 serum levels of SAA are strongly correlated with serum levels of inflammatory markers as well as measures of glycemic control
19755416 hepatic serum amyloid A expression is enhanced via protein kinase A-dependent mechanism
19729864 Associations of SAA1 and SAAP2 SNPs with carotid artery intima-media thickness, HDL and total cardiovascular disease events
19729864 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19726303 SAA levels are elevated in obstructive sleep apnea syndrome patients in close correlation to the severity of OSAS, which may contribute to the vulnerability of the patients to cardiovascular diseases
19549924 a highly conserved motif required for SAA binding to macrophages can, under acidic pH conditions and in an heparan sulfate -dependent manner, also act as a molecular switch, directing SAA misfolding into AA amyloid.
19453393 High expression of SAA in carcinomas was detected mostly in tumor cells, but not in normal mucosa. AG490, inhibitor of STAT3 activation, reduced SAA1 expression in SAS cells. SAA was up-regulated in HNSCC through the Janus kinase-STAT3 pathway
19171342 haptoglobin and serum amyloid A may have roles in atherothrombotic ischemic stroke
19167353 SAA stimulates CCL2 production via FPRL1 and, thus, contributes to atherosclerosis.
19007930 A novel oxidized low-density lipoprotein marker, serum amyloid A-LDL, is associated with obesity and the metabolic syndrome.
18768891 SAA, an endogenous ligand of the chemokine formyl peptide receptor-like 1 (FPRL1), stimulates CCL2 production in human monocytes by activating extracellular-signal regulated kinase (ERK) and NF-kappaB.
18726069 A review of how SAA contributes to tumour development and the acceleration of tumour progression and metastasis is presented.
18695905 up-regulation of SAA protein expression mediates the inhibitory effect of Ganoderma lucidum polysaccharides on tumor cell adhesion to endothelial cells.
18571179 SAA is a prothrombotic and proinflammatory mediator in acute coronary syndrome which may contribute to atherogenesis and its complications
18566366 suggest a potential role for SAA in inflammatory diseases through activation of TLR2
18385816 fifth day of observation but were not good predictors of mortality in septic shock.
18322992 The SAA-RAGE-stimulated NF-kappaB signaling pathway has an important role in the pathogenesis of rheumatoid arthritis.
18299466 The association between SAA and leptin suggests an interaction between these two adipokines, which may have implications in inflammatory processes related to obesity and the metabolic syndrome
17968686 Analysis of SAA1 gene polymorphisms showed the rarity of the putative amyloidogenic -13T allele in Greek populations may be related to low prevalence of AA amyloidosis development in Greek RA patients.
17968686 Observational study of gene-disease association. (HuGE Navigator)
17849429 we first show that SAA1 (coding for the major SAA isoform) but not SAA2 transcripts are expressed in human trabecular and cortical bone fractions and bone marrow.
17806085 SSA1 protein was identified in the blood of colon neoplasm patients.
17676666 SAA was quantitated using PVDF affinity probes and MALD-MS.
17552057 There is a relative deficiency of circulating cystatin C (CysC) in systemic inflammation in rheumatoid arthritis. Interaction between CysC and serum amyloid A protein explains this CysC deficiency and suggests CysC is regulating inflammatory responses.
17461519 SAA can be used as a valuable indicator of disease activity in ankylosing spondylitis.
17329325 SAA reduces hepatitis C virus (HCV) infectivity in a dose-dependent manner when added during HCV infection but not after virus entry.
17237436 SAA induced TF mRNA in PBMC within 30 min and optimal procoagulant activity within 4 h through activation of NF-kappaB via the ERK1/2 and p38 MAPK pathways. SAA-induced TF was partially inhibited by high-density lipoprotein.
17039310 Observational study of gene-disease association. (HuGE Navigator)
17039260 the SAA1 alpha/alpha genotype is a risk factor for amyloidosis in BD
17015746 binding of SAA to FPRL1 may contribute to the destruction of bone and cartilage via the promotion of synoviocyte hyperplasia and angiogenesis
16864904 serum amyloid A and C-reactive protein are expressed differently in exudates and transudates
16737350 Increased expression of SAA1 by adipocytes in obesity may play a critical role in local and systemic inflammation and free fatty acid production and could be a direct link between obesity and its comorbidities.
16651021 Data show that serum amyloid A dissociates apolipoprotein E from high density lipoprotein in cerebrospinal fluid.
16236134 We provide evidence that STAT3 plays an essential role in cytokine-driven SAA expression, although the human SAA gene shows no typical STAT3 response element.
16219644 Observational study of gene-disease association. (HuGE Navigator)
16155472 Within a subsample from the BELSTRESS study of 892 male subjects free of cardiovascular disease, dimensions of job stress from the job demand-control-support model were related to biomarkers of inflammation and infection.
16152805 Observational study of genotype prevalence. (HuGE Navigator)
16120612 Serum amyloid A has a role in promoting cholesterol efflux mediated by scavenger receptor B-I
16118480 Observational study of gene-disease association. (HuGE Navigator)
16011988 Observational study of gene-disease association. (HuGE Navigator)
15972323 Increased amyloid AA is associated with amyloidosis and familial Mediterranean fever
15910745 In this study, the SAA4 protein was examined in the high-density lipoprotein fraction of both healthy and diseased individuals.
15729583 SAA is expressed by subcutaneous white adipose tissue and its production at this site is regulated by nutritional status.
15561721 SR-BI plays a key role in SAA metabolism through its ability to interact with and internalize SAA and SAA influences HDL cholesterol metabolism through its inhibitory effects on SR-BI-mediated selective lipid uptake
15225640 Human hepatocytes stimulated by Lipopolysaccharide produced serum amyloid A protein.
15188355 The up-regulation of the A-SAA and FPRL1 genes in inflamed synovial tissue suggests an important role in the pathophysiology of inflammatory arthritis.
15170927 Observational study of gene-disease association. (HuGE Navigator)
15170927 SAA1a/a genotype is one genetic factor that confers a significant risk for amyloidosis in the Turkish FMF population but neither SAA1 nor SAA2 genotypes had a significant effect on SAA level.
15161744 Positive relationship between Tanis mRNA and the acute-phase protein serum amyloid A suggests an interaction between innate immune system responses and Tanis expression in muscle and adipose tissue.
15018633 Observational study of gene-disease association. (HuGE Navigator)
14871291 Saa1 is regulated by tumor necrosis factor-alpha, interleukin-6 and glucocorticoids in hepatic and epithelial cells
14738910 Results indicate a novel role for interleukin-18 in rheumatoid inflammation through the synovial serum amyloid A production.
14696796 Observational study of gene-disease association. (HuGE Navigator)
12762136 Data show higher SAA1 homozygosity in familial Mediterranean fever (FMF)-amyloidosis patients than in FMF patients, but no significant difference between controls and FMF patients with and without amyloidosis for the TNF-alpha-308 G-A allele.
12762135 Observational study of gene-disease association. (HuGE Navigator)
12762135 Data suggest that the frequency of the -13T serum amyloid A1 (SAA1) allele may explain the difference in prevalence of AA amyloidosis in Japanese and Caucasians.
12687559 Observational study of gene-disease association. (HuGE Navigator)
12410800 the region containing the C/EBPalpha,beta consensus binding site between the bases -252 and -175 is important for the glucocorticoid-induced SAA1 gene expression in HASMCs but not in HepG2 cells
12077270 The endogenous SAA1 gene has a cytokine-driven transcriptional disadvantage compared to SAA2 that is superseded by a marginal transcriptional advantage when glucocorticoids are present.
12056504 relation to cholesterol metabolism and cardiovascular disease (REVIEW)
11830469 human platelets specifically adhere to SAA in an RGD- and alphaIIbbeta3-dependent manner, indicating a role for SAA in modulating platelet adhesion
11592044 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGV      1 - 70
WAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY                       71 - 122
//

Text Mined References (221)

PMID Year Title
26945629 2016 Serum amyloid A1: Structure, function and gene polymorphism.
26937641 2016 Serum Amyloid A Induces Inflammation, Proliferation and Cell Death in Activated Hepatic Stellate Cells.
26750935 2016 Significance of amyloid A immunoexpression in the prognosis of renal cell carcinoma.
26642365 2016 Serum amyloid A impairs the antiinflammatory properties of HDL.
26300108 2015 The rate and significance of type 1/type 2 serum amyloid A protein gene polymorphisms in patients with ankylosing spondylitis and amyloidosis.
26297794 2015 Serum amyloid A1? induces paracrine IL-8/CXCL8 via TLR2 and directly synergizes with this chemokine via CXCR2 and formyl peptide receptor 2 to recruit neutrophils.
26135899 2015 Acute phase serum amyloid A induces proinflammatory cytokines and mineralization via toll-like receptor 4 in mesenchymal stem cells.
26130702 2015 Emerging functions of serum amyloid A in inflammation.
26052716 2015 Serum Amyloid A Stimulates PKR Expression and HMGB1 Release Possibly through TLR4/RAGE Receptors.
26037829 2015 Defective functionality of small, dense HDL3 subpopulations in ST segment elevation myocardial infarction: Relevance of enrichment in lysophosphatidylcholine, phosphatidic acid and serum amyloid A.
25963492 2015 Evaluation of procalcitonin, C-reactive protein, interleukin-6 & serum amyloid A as diagnostic biomarkers of bacterial infection in febrile patients.
25932604 2015 An involvement of SR-B1 mediated p38 MAPK signaling pathway in serum amyloid A-induced angiogenesis in rheumatoid arthritis.
25736604 2015 Structural studies of the C-terminal 19-peptide of serum amyloid A and its Pro ? Ala variants interacting with human cystatin C.
25656165 2015 Genetic polymorphisms of serum amyloid A1 and coronary artery disease risk.
25623898 2015 Conventional markers in determination of activity of sarcoidosis.
25607823 2015 Serum amyloid a truncations in type 2 diabetes mellitus.
25605163 2014 Serum amyloid A is a novel prognostic biomarker in hepatocellular carcinoma.
25531567 2015 Serum amyloid A and inflammation in diabetic kidney disease and podocytes.
25525305 2014 Serum amyloid A as a marker of persistent inflammation and an indicator of cardiovascular and renal involvement in patients with rheumatoid arthritis.
25394530 2015 Bc??--RFLP profiles for serum amiloid A1 and mutated MEFV gene prevalence in chronic renal failure patients requiring long-term hemodialysis.
25344970 2014 [Diagnostic importance of pentraxins at the early phase of acute pancreatitis].
25240611 2015 Dysregulated mature IL-1? production in familial Mediterranean fever.
25231464 2015 Serum amyloid A induces interleukin-1? secretion from keratinocytes via the NACHT, LRR and PYD domains-containing protein 3 inflammasome.
25073702 2014 Serum amyloid A is a retinol binding protein that transports retinol during bacterial infection.
24884805 2014 Differential expression of C-reactive protein and serum amyloid A in different cell types in the lung tissue of chronic obstructive pulmonary disease patients.
24854450 2014 Association of genetic polymorphisms of SAA1 (rs12218) with myocardial infarction in a Chinese population.
24846290 2014 Serum amyloid A induces NLRP-3-mediated IL-1? secretion in neutrophils.
24751653 2014 Adipose tissue-derived human serum amyloid a does not affect atherosclerotic lesion area in hSAA1+/-/ApoE-/- mice.
24732911 2014 Zinc regulates the acute phase response and serum amyloid A production in response to sepsis through JAK-STAT3 signaling.
24706838 2014 Structural mechanism of serum amyloid A-mediated inflammatory amyloidosis.
24632292 2014 Serum amyloid A induces mitogenic signals in regulatory T cells via monocyte activation.
24608426 2015 SAA1 polymorphisms are associated with variation in antiangiogenic and tumor-suppressive activities in nasopharyngeal carcinoma.
24469032 2015 A link between inflammation and metastasis: serum amyloid A1 and A3 induce metastasis, and are targets of metastasis-inducing S100A4.
24454983 2013 Proteomic analysis of plasma-purified VLDL, LDL, and HDL fractions from atherosclerotic patients undergoing carotid endarterectomy: identification of serum amyloid A as a potential marker.
24440699 2014 Effect of amino acid variations in the central region of human serum amyloid A on the amyloidogenic properties.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24228251 2013 Paired measurements of paraoxonase 1 and serum amyloid A as useful disease markers.
24209691 2013 High sensitive C-reactive protein and serum amyloid A are inversely related to serum bilirubin: effect-modification by metabolic syndrome.
24171731 2013 SAA1 gene variants and childhood obesity in China.
24096654 2013 Calcitonin gene-related peptide upregulates serum amyloid A synthesis through activation of interleukin-6.
24061501 2013 Serum amyloid A, phospholipase A?-IIA and C-reactive protein as inflammatory biomarkers for prostate diseases.
24030940 2013 Serum amyloid A: expression throughout human ovarian folliculogenesis and levels in follicular fluid of women undergoing controlled ovarian stimulation.
23994331 2013 Serum amyloid A is independently related to apolipoprotein A-I but not to HDL-cholesterol in patients with angina pectoris.
23987125 2013 Associations of genetic polymorphisms of SAA1 with cerebral infarction.
23967285 2013 No evidence for a role of adipose tissue-derived serum amyloid a in the development of insulin resistance or obesity-related inflammation in hSAA1(+/-) transgenic mice.
23940069 2013 SAA1 genetic polymorphisms are associated with plasma glucose concentration in non-diabetic subjects.
23898911 2013 Rs12218 In SAA1 gene was associated with serum lipid levels.
23836469 2013 Interaction of serum amyloid A with human cystatin C--assessment of amino acid residues crucial for hCC-SAA formation (part II).
23776697 2013 Acute-phase serum amyloid a in osteoarthritis: regulatory mechanism and proinflammatory properties.
23750222 2013 Characterization of the oligomerization and aggregation of human Serum Amyloid A.
23623642 2013 Serum amyloid A stimulates lipoprotein-associated phospholipase A2 expression in vitro and in vivo.
23597931 2014 Comparison between clinical diagnosis and CSF biomarkers of Alzheimer disease in elderly patients with late onset psychosis: Helsinki Old Age Psychosis Study (HOPS).
23566403 2013 Serum amyloid A level is increased in neuromyelitis optica and atypical multiple sclerosis with smaller T2 lesion volume in brain MRI.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23522429 2013 Associations of SAA1 gene polymorphism with lipid lelvels and osteoporosis in Chinese women.
23454129 2013 Serum amyloid A stimulates macrophage foam cell formation via lectin-like oxidized low-density lipoprotein receptor 1 upregulation.
23437051 2013 The contribution of SAA1 polymorphisms to Familial Mediterranean fever susceptibility in the Japanese population.
23391827 2013 Prediction and experimental validation of a putative non-consensus binding site for transcription factor STAT3 in serum amyloid A gene promoter.
23357645 2013 Variant screening of the serum amyloid A1 gene and functional study of the p.Gly90Asp variant for its role in atherosclerosis.
23300020 2013 Serum amyloid a is associated with obesity and estrogen receptor-negative tumors in postmenopausal women with breast cancer.
23255027 2013 Elevated serum amyloid A is associated with venous thromboembolism.
23238662 2013 Acute-phase serum amyloid A protein and its implication in the development of type 2 diabetes in the KORA S4/F4 study.
23230824 2013 Human serum amyloid A (SAA) protein changes in acute epilepsy patients.
23223242 2013 Pathogenic serum amyloid A 1.1 shows a long oligomer-rich fibrillation lag phase contrary to the highly amyloidogenic non-pathogenic SAA2.2.
23171281 2012 Renal AA-amyloidosis in intravenous drug users--a role for HIV-infection?
23165195 2013 SAA does not induce cytokine production in physiological conditions.
22901189 2012 Improved diagnostic accuracy of pancreatic diseases with a combination of various novel serum biomarkers--case control study from Manipal Teaching Hospital, Pokhara, Nepal.
22827403 2012 Association of serum amyloid A with subclinical atherosclerosis in women with gestational diabetes.
22771314 2012 SAA1 is over-expressed in plasma of non small cell lung cancer patients with poor outcome after treatment with epidermal growth factor receptor tyrosine-kinase inhibitors.
22768267 2012 Serum uric acid levels are associated with polymorphism in the SAA1 gene in Chinese subjects.
22766792 2012 A serum amyloid A-positive hepatocellular neoplasm arising in alcoholic cirrhosis: a previously unrecognized type of inflammatory hepatocellular tumor.
22552174 Serum amyloid a and C-reactive protein independently predict the recurrences of atrial fibrillation after cardioversion in patients with preserved left ventricular function.
22532826 2012 The acute phase protein Serum Amyloid A induces lipolysis and inflammation in human adipocytes through distinct pathways.
22447522 2013 Serum amyloid A (SAA) induces pentraxin 3 (PTX3) production in rheumatoid synoviocytes.
22371903 2012 AA amyloid quantification in biopsy samples from the stomach.
22367597 2012 Serum amyloid A levels associated with gastrointestinal manifestations in Henoch-Schönlein purpura.
22341353 2012 Purification, identification and profiling of serum amyloid A proteins from sera of advanced-stage cancer patients.
22300576 2012 Large-scale isotype-specific quantification of Serum amyloid A 1/2 by multiple reaction monitoring in crude sera.
22131810 2011 Colocalization of serum amyloid a with microtubules in human coronary artery endothelial cells.
22076945 2012 Acute-phase serum amyloid A regulates tumor necrosis factor ? and matrix turnover and predicts disease progression in patients with inflammatory arthritis before and after biologic therapy.
22011672 Amyloid A amyloidosis secondary to rheumatoid arthritis: pathophysiology and treatments.
21953030 2012 Analysis of acute-phase proteins, AHSG, C3, CLI, HP and SAA, reveals distinctive expression patterns associated with breast, colorectal and lung cancer.
21876610 2011 Serum amyloid alpha in parapneumonic effusions.
21624307 2011 [Association between serum amyloid protein A1 polymorphisms and carotid intima media thickness in Han Chinese].
21569756 2011 Identification of regions responsible for heparin-induced amyloidogenesis of human serum amyloid A using its fragment peptides.
21465531 2011 PTX3, a key component of innate immunity, is induced by SAA via FPRL1-mediated signaling in HAECs.
21449704 2011 Polymorphisms in the SAA1 gene are associated with ankle-to-brachial index in Han Chinese healthy subjects.
21325601 2011 Serum amyloid A overrides Treg anergy via monocyte-dependent and Treg-intrinsic, SOCS3-associated pathways.
21309051 2011 Decreased variation of inflammatory markers in gestational diabetes.
21141971 2011 Identification and validation of SAA as a potential lung cancer biomarker and its involvement in metastatic pathogenesis of lung cancer.
21124955 2010 Genome-wide association study identifies two novel regions at 11p15.5-p13 and 1p31 with major impact on acute-phase serum amyloid A.
21103356 2010 Polymorphisms in the SAA1/2 gene are associated with carotid intima media thickness in healthy Han Chinese subjects: the Cardiovascular Risk Survey.
21067563 2010 Intestinal epithelial serum amyloid A modulates bacterial growth in vitro and pro-inflammatory responses in mouse experimental colitis.
20979827 2010 [Association of genetic polymorphisms of serum amyloid protein A1 with plasma high density lipoproteins cholesterol].
20964562 2011 A combined biomarker pattern improves the discrimination of lung cancer.
20877498 2010 Proteomic analysis of haptoglobin and amyloid A protein levels in patients with vivax malaria.
20869715 2011 The anti-atherogenic aspect of metformin treatment in insulin resistant women with the polycystic ovary syndrome: role of the newly established pro-inflammatory adipokine Acute-phase Serum Amyloid A; evidence of an adipose tissue-monocyte axis.
20853849 2010 Serum amyloid A activates peroxisome proliferator-activated receptor ? through extracellularly regulated kinase 1/2 and COX-2 expression in hepatocytes.
20713982 2010 Expression of serum amyloid a in human ovarian epithelial tumors: implication for a role in ovarian tumorigenesis.
20677144 2010 [Distribution of genetic polymorphisms of serum amyloid protein A1 in healthy Chinese Han and Uighur populations in Xinjiang].
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20502455 2010 Serum amyloid A is elevated in the serum of lung cancer patients with poor prognosis.
20463814 2010 Elevation of intact and proteolytic fragments of acute phase proteins constitutes the earliest systemic antiviral response in HIV-1 infection.
20435930 2010 Acute serum amyloid A induces migration, angiogenesis, and inflammation in synovial cells in vitro and in a human rheumatoid arthritis/SCID mouse chimera model.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20184536 2010 Evaluation of C-reactive protein and serum amyloid A in the detection of inflammatory and infectious diseases in children.
20177146 2010 A pertussis toxin sensitive G-protein-independent pathway is involved in serum amyloid A-induced formyl peptide receptor 2-mediated CCL2 production.
20061576 2010 Myeloperoxidase and serum amyloid A contribute to impaired in vivo reverse cholesterol transport during the acute phase response but not group IIA secretory phospholipase A(2).
20022911 2010 Two-protein signature of novel serological markers apolipoprotein-A2 and serum amyloid alpha predicts prognosis in patients with metastatic renal cell cancer and improves the currently used prognostic survival models.
19925664 2009 Injury severity and serum amyloid A correlate with plasma oxidation-reduction potential in multi-trauma patients: a retrospective analysis.
19922330 2009 Differential affinity of serum amyloid A1 isotypes for high-density lipoprotein.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19850938 2010 Secretory phospholipase A2, group IIA is a novel serum amyloid A target gene: activation of smooth muscle cell expression by an interleukin-1 receptor-independent mechanism.
19833744 2009 Serum amyloid A and C-reactive protein concentrations are differently associated with markers of autoimmunity in patients with primary Sjögren's syndrome.
19758820 2009 Association of serum amyloid A levels with adipocyte size and serum levels of adipokines: differences between men and women.
19755416 2009 Docosahexaenoic acid enhances hepatic serum amyloid A expression via protein kinase A-dependent mechanism.
19729864 2009 Association of genetic variation in serum amyloid-A with cardiovascular disease and interactions with IL6, IL1RN, IL1beta and TNF genes in the Cardiovascular Health Study.
19726303 2009 [Clinical implications of serum amyloid A level in patients with obstructive sleep apnea].
19549924 2009 Heparan sulfate promotes the aggregation of HDL-associated serum amyloid A: evidence for a proamyloidogenic histidine molecular switch.
19453393 2010 Aberrant expression of serum amyloid A in head and neck squamous cell carcinoma.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19171342 2009 Usefulness of haptoglobin and serum amyloid A proteins as biomarkers for atherothrombotic ischemic stroke diagnosis confirmation.
19167353 2009 Activation of formyl peptide receptor like-1 by serum amyloid A induces CCL2 production in human umbilical vein endothelial cells.
19007930 2009 A novel oxidized low-density lipoprotein marker, serum amyloid A-LDL, is associated with obesity and the metabolic syndrome.
18768891 2008 Serum amyloid A induces CCL2 production via formyl peptide receptor-like 1-mediated signaling in human monocytes.
18726069 2009 Serum amyloid A: an acute-phase protein involved in tumour pathogenesis.
18695905 2008 Serum amyloid A mediates the inhibitory effect of Ganoderma lucidum polysaccharides on tumor cell adhesion to endothelial cells.
18571179 2009 Serum amyloid A may potentiate prothrombotic and proinflammatory events in acute coronary syndromes.
18566366 2008 Cutting edge: TLR2 is a functional receptor for acute-phase serum amyloid A.
18385816 2008 Comparison of C-reactive protein and serum amyloid a protein in septic shock patients.
18322992 2008 Serum amyloid A activates nuclear factor-kappaB in rheumatoid synovial fibroblasts through binding to receptor of advanced glycation end-products.
18299466 2008 Serum concentrations and expressions of serum amyloid A and leptin in adipose tissue are interrelated: the Genobin Study.
17968686 2007 Analysis of SAA1 gene polymorphisms in the Greek population: rheumatoid arthritis and FMF patients relative to normal controls. Homogeneous distribution and low incidence of AA amyloidosis.
17849429 2008 Expression of serum amyloid A transcripts in human bone tissues, differentiated osteoblast-like stem cells and human osteosarcoma cell lines.
17806085 2007 Analyses of intricate kinetics of the serum proteome during and after colon surgery by protein expression time series.
17676666 2007 Targeted protein quantitation and profiling using PVDF affinity probe and MALDI-TOF MS.
17552057 2007 Cystatin C binds serum amyloid A, downregulating its cytokine-generating properties.
17461519 2007 Serum amyloid a as a useful indicator of disease activity in patients with ankylosing spondylitis.
17329325 2007 Human serum amyloid A protein inhibits hepatitis C virus entry into cells.
17237436 2007 Serum amyloid A induces monocyte tissue factor.
17039310 2006 SAA1 gene polymorphisms and the risk of AA amyloidosis in Japanese patients with rheumatoid arthritis.
17039260 2007 SAA1 alpha/alpha alleles in Behçet's disease related amyloidosis.
17015746 2006 Serum amyloid A binding to formyl peptide receptor-like 1 induces synovial hyperplasia and angiogenesis.
16864904 2006 The acute-phase proteins serum amyloid A and C reactive protein in transudates and exudates.
16737350 2006 Acute-phase serum amyloid A: an inflammatory adipokine and potential link between obesity and its metabolic complications.
16651021 2006 Serum amyloid A (SAA)-induced remodeling of CSF-HDL.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16236134 2005 Essential role of STAT3 in cytokine-driven NF-kappaB-mediated serum amyloid A gene expression.
16219644 2006 Significance of SAA1.3 allele genotype in Japanese patients with amyloidosis secondary to rheumatoid arthritis.
16155472 2005 Associations between dimensions of job stress and biomarkers of inflammation and infection.
16152805 2005 The frequencies of the serum amyloid A2 alleles in healthy (Turkish, Azerbaijan and Kazakh) populations.
16120612 2005 Serum amyloid A promotes cholesterol efflux mediated by scavenger receptor B-I.
16118480 Genetic risk factors of amyloidogenesis in familial Mediterranean fever.
16011988 2005 Serum amyloid A serum concentrations and genotype do not explain low incidence of amyloidosis in Hyper-IgD syndrome.
15972323 2005 Clinicopathological and epidemiological analysis of amyloidosis in Turkish patients.
15910745 2005 Novel truncated isoforms of constitutive serum amyloid A detected by MALDI mass spectrometry.
15729583 2005 Serum amyloid A: production by human white adipocyte and regulation by obesity and nutrition.
15561721 2005 Serum amyloid A is a ligand for scavenger receptor class B type I and inhibits high density lipoprotein binding and selective lipid uptake.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225640 2004 Lipopolysaccharide signaling induces serum amyloid A (SAA) synthesis in human hepatocytes in vitro.
15188355 2004 Local expression of the serum amyloid A and formyl peptide receptor-like 1 genes in synovial tissue is associated with matrix metalloproteinase production in patients with inflammatory arthritis.
15170927 2004 Influence of Serum Amyloid A (SAA1) and SAA2 gene polymorphisms on renal amyloidosis, and on SAA/C-reactive protein values in patients with familial mediterranean fever in the Turkish population.
15161744 2004 Relationship between serum amyloid A level and Tanis/SelS mRNA expression in skeletal muscle and adipose tissue from healthy and type 2 diabetic subjects.
15018633 2004 Amyloidosis in familial Mediterranean fever patients: correlation with MEFV genotype and SAA1 and MICA polymorphisms effects.
14871291 2004 Regulation of the human acute phase serum amyloid A genes by tumour necrosis factor-alpha, interleukin-6 and glucocorticoids in hepatic and epithelial cell lines.
14738910 2004 Interleukin-18 induces serum amyloid A (SAA) protein production from rheumatoid synovial fibroblasts.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14696796 Analysis of the modifying effects of SAA1, SAA2 and TNF-alpha gene polymorphisms on development of amyloidosis in FMF patients.
12973732 2003 Identification and validation of a potential lung cancer serum biomarker detected by matrix-assisted laser desorption/ionization-time of flight spectra analysis.
12857601 2003 mRNA expression and release of interleukin-8 induced by serum amyloid A in neutrophils and monocytes.
12762136 2003 Serum amyloid A1 and tumor necrosis factor-alpha alleles in Turkish familial Mediterranean fever patients with and without amyloidosis.
12762135 2003 An allele of serum amyloid A1 associated with amyloidosis in both Japanese and Caucasians.
12687559 2003 The contribution of genotypes at the MEFV and SAA1 loci to amyloidosis and disease severity in patients with familial Mediterranean fever.
12606051 2003 Detection of novel truncated forms of human serum amyloid A protein in human plasma.
12557751 2002 Acute-phase, but not constitutive serum amyloid A (SAA) is chemotactic for cultured human aortic smooth muscle cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12410800 2002 Transcriptional regulation of serum amyloid A1 gene expression in human aortic smooth muscle cells involves CCAAT/enhancer binding proteins (C/EBP) and is distinct from HepG2 cells.
12077270 2002 Differential glucocorticoid enhancement of the cytokine-driven transcriptional activation of the human acute phase serum amyloid A genes, SAA1 and SAA2.
12056504 Acute phase serum amyloid A, cholesterol metabolism, and cardiovascular disease.
12031974 2002 Tanis: a link between type 2 diabetes and inflammation?
12011456 2002 Transmissibility of systemic amyloidosis by a prion-like mechanism.
11946204 1971 The major proteins of human and monkey amyloid substance: Common properties including unusual N-terminal amino acid sequences.
11592044 2001 [The association between SA gene and essential hypertension in Han Chinese].
10753626 2000 Serum amyloid A is a chemotactic agonist at FPR2, a low-affinity N-formylpeptide receptor on mouse neutrophils.
10531386 1999 N(epsilon)-(carboxymethyl)lysine adducts of proteins are ligands for receptor for advanced glycation end products that activate cell signaling pathways and modulate gene expression.
10211414 1999 Revised nomenclature for serum amyloid A (SAA). Nomenclature Committee of the International Society of Amyloidosis. Part 2.
9892621 1999 A seven-transmembrane, G protein-coupled receptor, FPRL1, mediates the chemotactic activity of serum amyloid A for human phagocytic cells.
9823935 1998 Effect of serum amyloid A on selected in vitro functions of isolated human neutrophils.
9815279 1998 Widespread expression of serum amyloid A in histologically normal human tissues. Predominant localization to the epithelium.
9605178 1998 Serum amyloid A protein induces production of matrix metalloproteinases by human synovial fibroblasts.
9305847 1997 A model for p53-induced apoptosis.
9252455 1997 Extracellular matrix-anchored serum amyloid A preferentially induces mast cell adhesion.
8995276 1997 Characterization of high affinity binding between laminin and the acute-phase protein, serum amyloid A.
8783012 1996 Characterization of human serum amyloid A protein isoforms separated by two-dimensional electrophoresis by liquid chromatography/electrospray ionization tandem mass spectrometry.
8670280 1996 A protein AA-variant derived from a novel serum AA protein, SAA1 delta, in an individual from Papua New Guinea.
8512321 1993 A novel polymorphism of human serum amyloid A protein, SAA1 gamma, is characterized by alanines at both residues 52 and 57.
8188252 1994 The human serum amyloid A protein (SAA) superfamily gene cluster: mapping to chromosome 11p15.1 by physical and genetic linkage analysis.
7851899 1994 Use of somatic cell hybrids and fluorescence in situ hybridization to localize the functional serum amyloid A (SAA) genes to chromosome 11p15.4-p15.1 and the entire SAA superfamily to chromosome 11p15.
7655463 1995 A novel allelic variant of serum amyloid A, SAA1 gamma: genomic evidence, evolution, frequency, and implication as a risk factor for reactive systemic AA-amyloidosis.
7636186 1995 A novel biologic function of serum amyloid A. Induction of T lymphocyte migration and adhesion.
7561109 1995 Serum amyloid A induces calcium mobilization and chemotaxis of human monocytes by activating a pertussis toxin-sensitive signaling pathway.
7516407 1994 Serum amyloid A is a chemoattractant: induction of migration, adhesion, and tissue infiltration of monocytes and polymorphonuclear leukocytes.
7115671 1982 Amino acid sequence of amyloid-related apoprotein (apoSAA1) from human high-density lipoprotein.
6155694 1980 An unusually large (83 amino acid residues) amyloid fibril protein AA from a patient with Waldenström's macroglobulinaemia and amyloidosis.
5056669 1972 The amino acid sequence of a major nonimmunoglobulin component of some amyloid fibrils.
5055786 1972 Amino acid sequence of an amyloid fibril protein of unknown origin.
4816450 1974 The complete amino-acid sequence of non-immunoglobulin amyloid fibril protein AS in rheumatoid arthritis.
3839415 1985 Human serum amyloid A (SAA): biosynthesis and postsynthetic processing of preSAA and structural variants defined by complementary DNA.
3800865 1986 DNA sequence evidence for polymorphic forms of human serum amyloid A (SAA).
3442653 1987 Degradation and deposition of amyloid AA fibrils are tissue specific.
3183061 1988 Human serum amyloid A. Three hepatic mRNAs and the corresponding proteins in one person.
2890635 1987 Structure of a human serum amyloid A gene and modulation of its expression in transfected L cells.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.
2595451 1989 A fine-structure deletion map of human chromosome 11p: analysis of J1 series hybrids.
2017667 1991 Highly polymorphic domains of the human serum amyloid A (SAA) gene GSAA1.
1971508 1990 Heterogeneity of human serum amyloid A protein. Five different variants from one individual demonstrated by cDNA sequence analysis.
1697614 1990 Serum amyloid A, an acute phase protein, inhibits platelet activation.
1656519 1991 The human acute-phase serum amyloid A gene family: structure, evolution and expression in hepatoma cells.
1546977 1992 Human serum amyloid A protein. Complete amino acid sequence of a new variant.
1463770 1992 Identification of two novel amyloid A protein subsets coexisting in an individual patient of AA-amyloidosis.
1259755 1976 The complete amino acid sequence of an amyloid fibril protein AA1 of unusual size (64 residues).