Property Summary

NCBI Gene PubMed Count 26
PubMed Score 42.56
PubTator Score 25.95

Knowledge Summary

Patent (9,777)

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.800 3.6e-02
ependymoma -2.100 4.1e-02
osteosarcoma 1.564 1.2e-06
group 3 medulloblastoma -1.700 1.6e-02
primitive neuroectodermal tumor -1.300 3.9e-03
non-small cell lung cancer 1.033 2.1e-06
interstitial cystitis -1.400 5.5e-05
pediatric high grade glioma -1.200 1.7e-03
atypical teratoid/rhabdoid tumor -1.300 4.9e-04
pilocytic astrocytoma -1.300 5.6e-04
subependymal giant cell astrocytoma -1.747 7.3e-03
type I diabetes mellitus -1.246 2.3e-02

MLP Assay (7)

AID Type Active / Inconclusive / Inactive Description
1801 summary 2 / 0 / 0 Summary of probe development efforts to identify agonists of Sphingosine 1-Phosphate Receptor 4 (S1P4)
2350 confirmatory 3 / 0 / 18 Late stage counterscreen assay for S1P4 antagonists: Fluorescence dose response cell-based screening assay for antagonists of the Sphingosine 1-Phosphate Receptor 5 (S1P5)
463129 confirmatory 1 / 0 / 5 Late-stage fluorescence-based dose-response cell-based assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 5 (S1P5) counterscreen assay
504867 confirmatory 10 / 0 / 2 Late-stage fluorescence-based dose-response cell-based counterscreen assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 5 (S1P5) agonist assay Set 2
504869 confirmatory 0 / 0 / 1 Late-stage fluorescence-based dose-response cell-based counterscreen assay to identify agonists of the Sphingosine 1-Phosphate Receptor 4 (S1P4): Sphingosine 1-Phosphate Receptor 5 (S1P5) antagonist assay Set 2
540309 summary 5 / 0 / 0 Summary of probe development efforts to identify agonists of Sphingosine 1-Phosphate Receptor 3 (S1P3)
540369 confirmatory 0 / 0 / 1 Late-stage fluorescence-based dose-response cell-based counterscreen assay to identify agonists of the Sphingosine 1-Phosphate Receptor 3 (S1P3): Sphingosine 1-Phosphate Receptor 5 (S1P5) agonist assay

Gene RIF (12)

PMID Text
25601519 TGF-beta2 dependent upregulation of S1P5 is required for the induction of pro-fibrotic CTGF by TGF-beta in mesangial cells.
24903384 Data show that sphingosine kinase SphK1 and sphingosine-1-phosphate (S1P) receptors S1P1, S1P2, S1P3, and S1P5 were expressed from primary, up to recurrent and secondary glioblastomas, with sphingosine kinase SphK2 levels were highest in primary tumors.
23551178 This report is the first to demonstrate a reduction in S1P5 in multiple sclerosis lesions, which parallels that of myelin loss.
22715976 Edg-5 receptor in brain endothelial cells contributes to optimal barrier formation and maintenance of immune quiescence of the barrier endothelium.
22541110 The decreased expression level of S1PR5 on NK cells is associated with graft versus host disease occurrence after allogeneic hematopoietic stem cell transplantation.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19474291 Results suggest that, under serum-starved conditions, sphingosine 1-phosphate (S1P) further upregulates autophagic activity through S1P(5)-dependent pathways in PC-3 cells.
19211033 The centrosomal sphingosine-1-phosphate receptor 5 might function as an intracellular target of sphingosine-1-phosphate linked to regulation of mitosis.
17918267 FTY720 induces time-dependent modulation of S1P receptors on human OPCs with consequent functional responses that are directly relevant for the remyelination process.
12427546 identify and characterize the gene; describe its expression in normal tissues and large granular lymphocyte leukemia monocytes
12234605 differences between hS1P(5) and rS1P(5) will be an important point to be considered in the development of selective receptor antagonists.
11705398 The molecular identity, functional properties, and expression profile of the S1P5 (Edg-8) receptor have been characterized.

AA Sequence

MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLVLGRHPRFHAP      1 - 70
MFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALTASVLSLLAIALERSLTMARR     71 - 140
GPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLDACSTVLPLYAKAYVLFCVLAFVGILAAICA    141 - 210
LYARIYCQVRANARRLPARPGTAGTTSTRARRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPAR    211 - 280
TCPVLLQADPFLGLAMANSLLNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRR    281 - 350
CLPPGLDGSFSGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD                          351 - 398
//

Text Mined References (26)

PMID Year Title
25601519 2015 Transforming growth factor ?2 (TGF-?2)-induced connective tissue growth factor (CTGF) expression requires sphingosine 1-phosphate receptor 5 (S1P5) in human mesangial cells.
24903384 2014 The role of sphingosine kinase isoforms and receptors S1P1, S1P2, S1P3, and S1P5 in primary, secondary, and recurrent glioblastomas.
24602016 2014 Lysophospholipid receptor nomenclature review: IUPHAR Review 8.
23551178 2014 Immunohistochemical detection of sphingosine-1-phosphate receptor 1 and 5 in human multiple sclerosis lesions.
22715976 2012 Sphingosine 1-phosphate receptor 5 mediates the immune quiescence of the human brain endothelial barrier.
22541110 2012 [Influence of NK cell S1PR5 expression on graft versus host disease in allogeneic hematopoietic stem cell transplantation].
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
19474291 2009 S1P(5) is required for sphingosine 1-phosphate-induced autophagy in human prostate cancer PC-3 cells.
19211033 2009 The sphingosine 1-phosphate receptor 5 and sphingosine kinases 1 and 2 are localised in centrosomes: possible role in regulating cell division.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
17918267 2008 FTY720 modulates human oligodendrocyte progenitor process extension and survival.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15530552 2004 Evidence for the presence of the sphingosine-1-phosphate receptor Edg-8 in human radial glial fibers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12648236 2003 Sphingosine-1-phosphate and its potentially paradoxical effects on critical parameters of cutaneous wound healing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427546 2002 Characterization of a human sphingosine-1-phosphate receptor gene (S1P5) and its differential expression in LGL leukemia.
12234605 2002 Comparative analysis of human and rat S1P(5) (edg8): differential expression profiles and sensitivities to antagonists.
12044878 2002 Identification of G protein-coupled receptor genes from the human genome sequence.
11705398 2001 Characterization of the human and mouse sphingosine 1-phosphate receptor, S1P5 (Edg-8): structure-activity relationship of sphingosine1-phosphate receptors.
11069896 2001 Nrg-1 belongs to the endothelial differentiation gene family of G protein-coupled sphingosine-1-phosphate receptors.
10799507 2000 Characterization of a novel sphingosine 1-phosphate receptor, Edg-8.
2834384 1988 Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.